DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lewinson-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216968X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216973X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216977X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216969X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216974X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216979X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr anti tag western anti tag western blot anti tag western Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216978X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216970X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-9 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216975X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-10 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216980X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216971X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-12 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216976X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation lewinson-2010-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lewinson O., Lee AT., Locher KP., Rees DC. DIP original experiment: DIP-216972X Nature structural & molecular biology 2010 IMEx A distinct mechanism for the ABC transporter BtuCD-BtuF revealed by the dynamics of complex formation. Lewinson O., Lee AT., Locher KP., Rees DC. Only protein-protein interactions imex curation btuc_ecoli Vitamin B12 import system permease protein BtuC btuC b1711 JW1701 protein protein ecoli Escherichia coli (strain K12) MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLKAGR btud_ecoli Vitamin B12 import ATP-binding protein BtuD btuD b1709 Vitamin B12-transporting ATPase JW1699 protein protein ecoli Escherichia coli (strain K12) MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAYGMNFRRLDIEGHRMLISTI metq_ecoli D-methionine-binding lipoprotein MetQ metQ b0197 JW0193 yaeC protein protein ecoli Escherichia coli (strain K12) MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQVAEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLVAVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEDKESPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW meti_ecoli D-methionine transport system permease protein MetI metI yaeE b0198 JW0194 protein protein ecoli Escherichia coli (strain K12) MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK metn_ecoli Methionine import ATP-binding protein MetN metN abc b0199 JW0195 protein protein ecoli Escherichia coli (strain K12) MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYV btuf_ecoli Vitamin B12-binding protein yadT btuF b0158 JW0154 protein protein ecoli Escherichia coli (strain K12) MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD mola_haein Molybdate-binding protein MolA molA Molybdate/tungstate-binding protein MolA HI_1472 protein protein haein Haemophilus influenzae MKLKSLLIACLLSSLSFSALADRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDGLKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYQKFYRTSYKPDNAAR 166842B3F4D2BBED molb_haein Molybdate import system permease protein MolB molB HI_1471 protein protein haein Haemophilus influenzae MQPDSYPKILFGLTLLLVITAVISLGIGRYSLSVPQIGQILWAKATALEIDPVQQQVIFQVRLPRILTALCVGAGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTILFGFGTLALVFLFSFKFNQRSLLMLILIGMILSGLFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLLSLDEKEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVGLIIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNVARSLSDAEIPISILTALIGAPLFGVLVYKLKRGGMNE 83298CCBCF2DC1F5 molc_haein Molybdate import ATP-binding protein MolC molC HI_1470 protein protein haein Haemophilus influenzae MNKALSVENLGFYYQAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLLNKQNFKFGETRNILTSENLTALFHLPMFEQQAQYKESFFTHFVPLYKTLLK AC54279C650C39F1 btuc-btud-4 3204762 N/A 3204775 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204776 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false meti-metn-3 3204763 N/A 3204777 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3204778 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204779 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false btuc-btuf-1 3204764 N/A 3204780 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3204775 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false btuc-btud-5 3204765 N/A 3204780 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204775 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204776 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false btuc-btud-6 3204766 N/A 3204775 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3204776 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false hi1471-hi1472-1 3204767 N/A 3204781 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3204782 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false btuc-btuf-2 3204768 N/A 3204780 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3204775 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false hi1470-hi1471-1 3204769 N/A 3204782 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204783 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hi1471-hi1470-1 3204770 N/A 3204782 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3204783 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false metn-metq-1 3204771 N/A 3204777 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3204779 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false hi1470-hi1471-2 3204772 N/A 3204781 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204782 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204783 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false metn-meti-1 3204773 N/A 3204778 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3204779 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false meti-metn-2 3204774 N/A 3204778 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204779 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false