DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nishio-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220915X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220913X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220920X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-6 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220918X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-7 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220916X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-8 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220914X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-9 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220919X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation nishio-2010-10 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. DIP original experiment: DIP-220917X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency. Nishio M., Kamiya Y., Mizushima T., Wakatsuki S., Sasakawa H., Yamamoto K., Uchiyama S., Noda M., McKay AR., Fukui K., Hauri HP., Kato K. Only protein-protein interactions imex curation mcfd2_human Multiple coagulation factor deficiency protein 2 SDNSF Neural stem cell-derived neuronal survival protein MCFD2 protein protein human Homo sapiens Human MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF lman1-mcfd2-1 3204053 N/A 3204061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-2 3204054 N/A 3204061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-3 3204055 N/A 3204061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-4 3204056 N/A 3204061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P49257:p.Arg45Ala R45A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-5 3204057 N/A 3204061 unspecified role unspecified role unspecified role unspecified role Q8NI22:p.Asp89Ala D89A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Region 44-56 Region 44-56 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false lman1-mcfd2-6 3204058 N/A 3204061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P49257:p.Arg45Ala R45A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-7 3204059 N/A 3204061 unspecified role unspecified role unspecified role unspecified role Q8NI22:p.Asp122Val D122V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lman1-mcfd2-8 3204060 N/A 3204061 unspecified role unspecified role unspecified role unspecified role Q8NI22:p.Asp122Val D122V mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3204062 unspecified role unspecified role unspecified role unspecified role Carbohydrate recognition domain Region 31-269 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false