DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mcgowan-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McGowan S., Oellig CA., Birru WA., Caradoc-Davies TT., Stack CM., Lowther J., Skinner-Adams T., Mucha A., Kafarski P., Grembecka J., Trenholme KR., Buckle AM., Gardiner DL., Dalton JP., Whisstock JC. DIP original experiment: DIP-215964X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases. McGowan S., Oellig CA., Birru WA., Caradoc-Davies TT., Stack CM., Lowther J., Skinner-Adams T., Mucha A., Kafarski P., Grembecka J., Trenholme KR., Buckle AM., Gardiner DL., Dalton JP., Whisstock JC. Only protein-protein interactions imex curation mcgowan-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined McGowan S., Oellig CA., Birru WA., Caradoc-Davies TT., Stack CM., Lowther J., Skinner-Adams T., Mucha A., Kafarski P., Grembecka J., Trenholme KR., Buckle AM., Gardiner DL., Dalton JP., Whisstock JC. DIP original experiment: DIP-215965X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases. McGowan S., Oellig CA., Birru WA., Caradoc-Davies TT., Stack CM., Lowther J., Skinner-Adams T., Mucha A., Kafarski P., Grembecka J., Trenholme KR., Buckle AM., Gardiner DL., Dalton JP., Whisstock JC. Only protein-protein interactions imex curation q8il11_plaf7 PF3D7_1446200 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MYFSSLCKFLPISEKEKIYLNIVKKRFCKSNIYYNNNNNNIINYNKRGLKFYPFCNNLKKNINFVNINNKKGINFHSINKERKMASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKNVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILNSSKTSNEPVWWLPIINEYRATLNSKYADINNISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLNDAL lap-1 3203736 N/A 3203738 unspecified role unspecified role unspecified role unspecified role Region 84-605 Region 84-605 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lap-2 3203737 N/A 3203738 unspecified role unspecified role unspecified role unspecified role Region 84-605 Region 84-605 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false