DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mclellan-2010-1 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie McLellan JS., Chen M., Kim A., Yang Y., Graham BS., Kwong PD. DIP original experiment: DIP-133990X Nature structural & molecular biology 2010 IMEx Structural basis of respiratory syncytial virus neutralization by motavizumab. McLellan JS., Chen M., Kim A., Yang Y., Graham BS., Kwong PD. Only protein-protein interactions imex curation mclellan-2010-2 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie McLellan JS., Chen M., Kim A., Yang Y., Graham BS., Kwong PD. DIP original experiment: DIP-133991X Nature structural & molecular biology 2010 IMEx Structural basis of respiratory syncytial virus neutralization by motavizumab. McLellan JS., Chen M., Kim A., Yang Y., Graham BS., Kwong PD. Only protein-protein interactions imex curation fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN f-1 3202757 N/A 3202759 unspecified role unspecified role unspecified role unspecified role Region 1-513 Region 1-513 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false f-2 3202758 N/A 3202759 unspecified role unspecified role unspecified role unspecified role Region 1-513 Region 1-513 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false