DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rasola-2010-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. DIP original experiment: DIP-219187X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Activation of mitochondrial ERK protects cancer cells from death through inhibition of the permeability transition. Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. Only protein-protein interactions imex curation rasola-2010-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. DIP original experiment: DIP-219188X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Activation of mitochondrial ERK protects cancer cells from death through inhibition of the permeability transition. Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. Only protein-protein interactions imex curation rasola-2010-3 in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. DIP original experiment: DIP-219189X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Activation of mitochondrial ERK protects cancer cells from death through inhibition of the permeability transition. Rasola A., Sciacovelli M., Chiara F., Pantic B., Brusilow WS., Bernardi P. Only protein-protein interactions imex curation ppid_human Peptidyl-prolyl cis-trans isomerase D Cyclophilin-40 Cyclophilin-related protein PPID CYP40 CYPD Rotamase D 40 kDa peptidyl-prolyl cis-trans isomerase protein protein human Homo sapiens Human MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG ppid-mapk1-1 3202433 N/A 3202436 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3202437 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false gsk3b-ppid-1 3202434 N/A 3202436 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3202438 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false bax-gsk3b-1 3202435 N/A 3202439 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3202438 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation false false false