DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tapley-2010-1 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Tapley TL., Franzmann TM., Chakraborty S., Jakob U., Bardwell JC. DIP original experiment: DIP-220699X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Protein refolding by pH-triggered chaperone binding and release. Tapley TL., Franzmann TM., Chakraborty S., Jakob U., Bardwell JC. Only protein-protein interactions imex curation tapley-2010-2 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Tapley TL., Franzmann TM., Chakraborty S., Jakob U., Bardwell JC. DIP original experiment: DIP-220700X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Protein refolding by pH-triggered chaperone binding and release. Tapley TL., Franzmann TM., Chakraborty S., Jakob U., Bardwell JC. Only protein-protein interactions imex curation hdea_ecoli Acid stress chaperone HdeA hdeA yhhC yhiB b3510 JW3478 10K-S protein protein protein ecoli Escherichia coli (strain K12) MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM hdea-1 3201892 N/A 3201894 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hdea-2 3201893 N/A 3201894 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa532-label Alexa532-label alexa 532 label alexa 532 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3201894 unspecified role unspecified role fluorescence donor fluorescence donor bimane-label bimane-label bimane bimane label bimane certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false