DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yamashita-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. DIP original experiment: DIP-133974X Nature structural & molecular biology 2010 IMEx Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. Only protein-protein interactions imex curation yamashita-2010-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. DIP original experiment: DIP-133975X Nature structural & molecular biology 2010 IMEx Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. Only protein-protein interactions imex curation rho1_yeast GTP-binding protein RHO1 RHO1 YPR165W P9325.3 Rho-type GTPase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL 630B17E9E34CFE75 sec3_yeast Exocyst complex component SEC3 PSL1 YER008C SEC3 Protein PSL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSSKSPFKRKSHSRETSHDENTSFFHKRTISGSSAHHSRNVSQGAVPSSAPPVSGGNYSHKRNVSRASNSSQTSNFLAEQYERDRKAIINCCFSRPDHKTGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKPNNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTMSKKYYWETNSAKERTVFIKSLITLYIQTFEGHVPELVNWDLSLFYLDERSYQRAVITNRPGSVSPIKSPTSNFTTNTTQSVGSVPFSAPTERTRRSETESVNPVSTPASVEYHAGMKSLNKAPYSSNSTLNEVNKRYELEQQQQQEEAELRRLEEQKRLQLQKENEMKRLEEERRIKQEERKRQMELEHQRQLEEEERKRQMELEAKKQMELKRQRQFEEEQRLKKERELLEIQRKQREQETAERLKKEEQEALAKKEEEEKSKRNKVDNESYTQEINGKVDNLLEDLNAVLAEETETTPTMQNGTYVPERSTARAHDQLKKPLNIAKVESLGGSDLNDSISLSDEIAGLNTSNLSGEDQDEKNDLSFEKGDEVRYSNNFEGEAPHVYHEVSIIQEEAPAVSQKLILPEENNESEALIESKEEIKTMENIDDEVLLEILTDINWSIEDDADSMIERIDLRLAETEYLFNQNLLSLQKIGPNIRPYEDKVNDECHRIIPTLSLFLMEMSNFSNDIENVESQDNGLQVESANKKLLWNTLDELLKTVSLDEISLNQLLECPIREKNLPWMENQLNLLLKAFQAIGSDGNEVEYNLREISGLKQRLQFYEKVTKIFLNRIVEEMQKKFSNIRGQDISHDQMIRILTTLLIFSPLILFCKEISQKSYQAIVENWNVSIQPVYMELWTKKISQLQGIDTNDEKMNELSLSQLLNEWDTFRKERKTNDINPVFKNSFSLLTECLQTMRQECIVYQNFVEVFFHISSKHNFEEYIKHFNDPDAPPILLDTVKVMQSDREAAVIETQLVSRIFQPIVTRLSSYFVELVKAEPTVAPALTFYLENEIKSLESSNHEFLLSAVTRMYTQIKQVWSDNVEEQVLHFERISNATTNGEILPGILDLPVGLKNSEDLFQFAKRSMDIKDTDEGYESIELMNSSFRKLSIAATRSITHKEVNSSINPNLSDTAALNNDYMETISLLVNSNWLTEMLSMLNFNKDGIFDTSLQNVKKVFDVEKESYASFLLRDTMPKLTAFVYGVSNIIENTNNVNMTNPSRWAAYSRQNLENILLAYTSHEIETLVKRLHTHMVNDFGYHQENAINNVLCDKLWSCIQGQTVSLYLKLYTVIDKHYRGTNIRFTKNDIISAFEEYKNA 6F0C1BF13A77985E rho1-sec3-1 3201518 N/A 3201520 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3201521 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-320 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rho1-sec3-2 3201519 N/A 3201520 unspecified role unspecified role bait bait Region 1-188 Region 1-188 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P06780:p.Val43Ala V43A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06780:p.Phe44Ala F44A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06780:p.Gln68Ala Q68A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06780:p.Tyr71Ala Y71A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06780:p.Arg73Ala R73A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3201521 unspecified role unspecified role prey prey N-terminal domain Region 1-320 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P33332:p.Leu131Ala L131A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P33332:p.Lys136Ala K136A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P33332:p.Glu199Ala E199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false