IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ paik-2010-1 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-2 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. Re-ChIP experiment RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-3 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-4 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-5 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-8 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation paik-2010-9 mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Paik JC., Wang B., Liu K., Lue JK., Lin WC., Paik JC., Wang B., Liu K., Lue JK., Lin WC. RRP1B was determined to be of Human origin from primers. weeichil@bcm.tmc.edu The Journal of Biological Chemistry 2010 imex curation Only protein-protein interactions imex curation e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF rrp1b_human_gene Ribosomal RNA processing protein 1 homolog B RRP1B KIAA0179 gene gene human Homo sapiens Human rbl1_human_gene RBL1 protein gene gene gene human Homo sapiens Human e2f2_human Transcription factor E2F2 E2F2 protein protein human Homo sapiens Human MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN e2f3_human Transcription factor E2F3 E2F3 KIAA0075 protein protein human Homo sapiens Human MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS rrp1b_human Ribosomal RNA processing protein 1 homolog B RRP1B RRP1-like protein B KIAA0179 protein protein human Homo sapiens Human MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFYCMWVQDEPLLQEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYMLIRLVLRQSFEVLKRNGWEESRIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVGGKELLADQNLKFIDPFCKIAAKTKDHTLVQTIARGVFEAIVDQSPFVPEETMEEQKTKVGDGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDERGRDDCGTFEDTGPLLQFDYKAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSPRAHREMLESAVLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTPAWPPLQQEGPPTGPAEGANSHTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMRVMSNLVEHNGVLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF casp3_human_gene Caspase-3 CPP32 CASP3 gene gene human Homo sapiens Human casp7_human_gene Human CASP7 gene gene gene human Homo sapiens Human rrna promoter rRNA promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CCAGAGGACAGCGTGTCAGCA reverse sequence given only: maps to one of 45S rDNA repeat units encoding a 45S rRNA precursor, transcribed by RNA polymerase I, which is processed to form the 18S, 5.8S and 28S rRNAs. tp73_human_gene Human TP73 gene gene gene human Homo sapiens Human kith_human_gene Thymidine kinase, cytosolic TK1 gene gene human Homo sapiens Human e2f1_human_gene Human transcription factor E2F1 gene gene human Homo sapiens Human 235a34t4-1 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318328 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RRP1B promoter from position +79 to +259 association association false false false Figure 2E, 4D e2f1-rrp1b-1 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318329 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 2E -2 e2f1-rbl1_human_gene-1 3318318 N/A 3318330 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318329 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 2E -3 e2f2-rbl1_human_gene-1 3318318 N/A 3318331 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318329 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 2E -4 e2f1-rrp1b-2 3318318 N/A 3318332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318333 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4Da e2f1-casp3-1 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318334 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4D-3 e2f1-rrna promoter-1 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318335 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false 4D-4 e2f1-casp3-2 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318336 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4D-5 e2f1-tp73_human_gene-1 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318337 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4D-6 e2f1-casp3-3 3318318 N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318338 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4D-7 e2f1-casp7_human_gene-2 3318318 N/A 3318332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318334 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4Db e2f1-rrna promoter-3 3318318 N/A 3318332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318335 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false 4Dc e2f1-rrp1b-8 3318318 N/A 3318332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318328 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RRP1B promoter from position +79 to +259 association association false false false Figure 4Dd e2f1-rrp1b-3 3318319 N/A 3318332 unspecified role unspecified role bait bait partially purified partially purified N/A 3318327 unspecified role unspecified role prey prey partially purified partially purified N/A 3318328 unspecified role unspecified role prey prey partially purified partially purified promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RRP1B promoter from position +79 to +259 association association false false false Figure 4E-1 e2f1-casp7_human_gene-1 3318319 N/A 3318327 unspecified role unspecified role prey prey partially purified partially purified N/A 3318334 unspecified role unspecified role prey prey partially purified partially purified promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3318332 unspecified role unspecified role bait bait partially purified partially purified association association false false false 4E-2 e2f1-rrna promoter-2 3318319 N/A 3318332 unspecified role unspecified role bait bait partially purified partially purified N/A 3318327 unspecified role unspecified role prey prey partially purified partially purified N/A 3318335 unspecified role unspecified role prey prey partially purified partially purified association association false false false 4E-3 rrp1b-casp7_human_gene-1 3318320 N/A 3318327 unspecified role unspecified role bait bait purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3318332 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep in vitro translated in vitro translated protein in vitro translated n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 5A 21311213-1 3318321 N/A 3318332 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 6B e2f1-rrp1b-4 3318322 N/A 3318332 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318327 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 6Bi rrp1b-e2f1-1 3318323 N/A 3318327 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3318332 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6C e2f1-rrp1b-5 3318324 N/A 3318327 unspecified role unspecified role bait bait purified purified DNA-binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false DNA-binding domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3318332 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 6D e2f1-rrp1b-6 3318325 N/A 3318327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3318332 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7C e2f1-rrp1b-7 3318326 N/A 3318327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3318332 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7Ci