DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ parry-2009-1 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134896X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation parry-2009-2 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134894X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation parry-2009-3 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134898X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation parry-2009-4 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134897X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation parry-2009-5 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134895X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation parry-2009-6 in vitro In vitro pull down pull down autoradiography autoradiography Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. DIP original experiment: DIP-134899X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Complex regulation of the TIR1/AFB family of auxin receptors. Parry G., Calderon-Villalobos LI., Prigge M., Peret B., Dharmasiri S., Itoh H., Lechner E., Gray WM., Bennett M., Estelle M. Only protein-protein interactions imex curation grh1_arath GRR1-like protein 1 Protein AUXIN SIGNALING F-BOX 1 GRH1 AFB1 FBL18 GER1 LRF1 F4C21.11 At4g03190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLRFPPKVLEHILSFIDSNEDRNSVSLVCKSWFETERKTRKRVFVGNCYAVSPAAVTRRFPEMRSLTLKGKPHFADYNLVPDGWGGYAWPWIEAMAAKSSSLEEIRMKRMVVTDECLEKIAASFKDFKVLVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFSNCKQLQSLSGLWDVLPEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDLDATNIPLTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCFRLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSGLLSDKAFKYIGKHAKKVRMLSIAFAGDSDLMLHHLLSGCESLKKLEIRDCPFGDTALLEHAAKLETMRSLWMSSCFVSFGACKLLSQKMPRLNVEVIDEHPPESRPESSPVERIYIYRTVAGPRMDTPEFVWTIHKNPENGVSHLAIK iaa3_arath Auxin-responsive protein IAA3 IAA3 SHY2 At1g04240 F19P19.32 Indoleacetic acid-induced protein 3 Short hypocotyl Suppressor of HY2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS afb2_arath Protein AUXIN SIGNALING F-BOX 2 AFB2 LRF2 MDJ14.12 At3g26810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNYFPDEVIEHVFDFVTSHKDRNAISLVCKSWYKIERYSRQKVFIGNCYAINPERLLRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVLPWIEALARSRVGLEELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEIDDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALARLMACAPQIVDLGVGSYENDPDSESYLKLMAVIKKCTSLRSLSGFLEAAPHCLSAFHPICHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGLVAISAGCPKLHSILYFCQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLSGLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLADVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKLYLYRTVVGTRMDAPPFVWIL iaa3-grh1-1 3201306 N/A 3201312 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201313 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false iaa3-tir1-2 3201307 N/A 3201314 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201313 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false iaa7-grh1-1 3201308 N/A 3201312 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201315 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false iaa3-afb2-1 3201309 N/A 3201316 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201313 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false iaa7-tir1-3 3201310 N/A 3201314 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201315 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false iaa7-afb2-1 3201311 N/A 3201316 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3201315 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false