DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ morar-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. DIP original experiment: DIP-131964X Structure (London, England : 1993) 2009 IMEx Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB. Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. Only protein-protein interactions imex curation morar-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. DIP original experiment: DIP-131965X Structure (London, England : 1993) 2009 IMEx Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB. Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. Only protein-protein interactions imex curation q9wvy4_entfc linB protein protein entfc Enterococcus faecium Streptococcus faecium MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE linb-1 3200842 N/A 3200844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false linb-2 3200843 N/A 3200844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false