DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ goetz-2010-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215838X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215847X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215840X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215844X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215842X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-6 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215848X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-7 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215839X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215845X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-9 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215843X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215846X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215841X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation goetz-2010-12 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. DIP original experiment: DIP-215849X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation. Goetz R., Nakada Y., Hu MC., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova AV., Razzaque MS., Moe OW., Kuro-o M., Mohammadi M. Only protein-protein interactions imex curation klot_mouse Klotho Kl protein protein mouse Mus musculus Mouse MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWARFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVHANITPVVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRSYK fgfr1_human Fibroblast growth factor receptor 1 FGFR1 FGFBR FLG FLT2 Fms-like tyrosine kinase 2 Proto-oncogene c-Fgr BFGFR CEK HBGFR Basic fibroblast growth factor receptor 1 N-sam protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR fgfr1_mouse Fibroblast growth factor receptor 1 Fgfr1 Flg Basic fibroblast growth factor receptor 1 MFR Proto-oncogene c-Fgr protein protein mouse Mus musculus Mouse MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR mint Receptor for basic fibroblast growth factor. A shorter form of the receptor could be a receptor for FGF1 (aFGF) homomint q61851-1 Fibroblast growth factor receptor 3 Fgfr3 Mfr3 Sam3 IIIc Heparin-binding growth factor receptor protein protein mouse Mus musculus Mouse MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTPGGPSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT fgf23_human Fibroblast growth factor 23 FGF23 HYPF Phosphatonin Tumor-derived hypophosphatemia-inducing factor UNQ3027/PRO9828 protein protein human Homo sapiens Human MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI fgfr4_mouse Fibroblast growth factor receptor 4 Fgfr4 Fgfr-4 Mpk-11 Protein-tyrosine kinase receptor MPK-11 protein protein mouse Mus musculus Mouse MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERGRHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTSISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQVLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATPEARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESRSSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFSHDPLPLEPSPFPFSDSQTT kl-fgfr1-1 3200357 N/A 3200369 unspecified role unspecified role bait bait Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3200370 unspecified role unspecified role prey prey Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fgfr1-kl-3 3200358 N/A 3200371 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200369 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false fgfr3-kl-1 3200359 N/A 3200369 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3200372 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false fgfr1-kl-4 3200360 N/A 3200369 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3200370 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fgf23-fgfr1-1 3200361 N/A 3200373 unspecified role unspecified role bait bait Region 28-251 Region 28-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3200370 unspecified role unspecified role prey prey Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fgfr3-fgf23-1 3200362 N/A 3200372 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200373 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3200369 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false fgfr1-fgf23-2 3200363 N/A 3200371 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200373 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3200369 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false fgf23-fgfr1-2 3200364 N/A 3200373 unspecified role unspecified role unspecified role unspecified role Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3200369 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3200370 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 142-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false fgf23-kl-2 3200365 N/A 3200369 unspecified role unspecified role prey prey Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3200373 unspecified role unspecified role bait bait Region 28-251 Region 28-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kl-fgf23-2 3200366 N/A 3200369 unspecified role unspecified role bait bait Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200373 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 28-200 Region 28-200 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false fgfr4-kl-1 3200367 N/A 3200369 unspecified role unspecified role prey prey Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200374 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false fgfr4-fgf23-1 3200368 N/A 3200374 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3200373 unspecified role unspecified role prey prey Region 180-251 Region 180-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3200369 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ectodomain Region 35-982 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false