DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chandran-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chandran V., Fronzes R., Duquerroy S., Cronin N., Navaza J., Waksman G. DIP original experiment: DIP-219649X Nature 2009 IMEx Structure of the outer membrane complex of a type IV secretion system. Chandran V., Fronzes R., Duquerroy S., Cronin N., Navaza J., Waksman G. Only protein-protein interactions imex curation chandran-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chandran V., Fronzes R., Duquerroy S., Cronin N., Navaza J., Waksman G. DIP original experiment: DIP-219650X Nature 2009 IMEx Structure of the outer membrane complex of a type IV secretion system. Chandran V., Fronzes R., Duquerroy S., Cronin N., Navaza J., Waksman G. Only protein-protein interactions imex curation q46704_ecolx traO protein protein ecolx Escherichia coli MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITHAFGDSESRTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVRHAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGRGAVATGTASPDVRRVQIGEDN DCAE0E16EEB542FC q46702_ecolx traN protein protein ecolx Escherichia coli MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGRNES 43ACC8EA9591FBAB q46705_ecolx traF protein protein ecolx Escherichia coli MARKSVDVDQELDENTGDGEFESERGGFNGSNRRSAPRMKAFVILMALLALVFIGITVMGKIRAPAKAEADKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSPTDARAVQAAAQADADAGSSNTGARTSNKRKEPSPEELAMQRRLGGELAQTNQAATSNSPGAQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIPCGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIVNIDSAGTNSLGSAGIPGQVDAHMWERLAGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGGQLASEALRSYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN 3F94CFD32ED8316B traf-tran-2 3199611 N/A 3199613 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199614 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3199615 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-386 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false traf-tran-4 3199612 N/A 3199613 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199614 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3199615 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 160-386 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false