DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ maclellan-2009-1 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134801X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-2 baciu Bacillus subtilis pull down pull down predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134807X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-3 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134805X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-4 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134803X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-5 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134802X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134804X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation maclellan-2009-7 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. DIP original experiment: DIP-134806X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A two-subunit bacterial sigma-factor activates transcription in Bacillus subtilis. MacLellan SR., Guariglia-Oropeza V., Gaballa A., Helmann JD. Only protein-protein interactions imex curation rpob_bacsu DNA-directed RNA polymerase subunit beta rpoB crsE rfm RNA polymerase subunit beta Transcriptase subunit beta BSU01070 protein protein bacsu Bacillus subtilis MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGLREMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETGEVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVIPNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLIGENEYLRNTLDKDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHIKNRLFNQRLAETLVDPETGEILAEKGQILDRRTLDKVLPYLENGIGFRKLYPNGGVVEDEVTLQSIKIFAPTDQEGEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVGDTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQANARLDDEGAFIDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMQPEAPFVGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRRYEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMELGELALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHGNKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIASPVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDEEDAKQADGLALSGDEEPEETASADVERDVVTKE 713FFF19F0987443 sigo_bacsu RNA polymerase sigma factor SigO sigO yvrI BSU33230 protein protein bacsu Bacillus subtilis MKHPIVKHFLSNPQHYRLFKNVMESPNEKDARSLDELFKQFYKEIRIVKYMNSMIRIFSIDFDKRVRKNQKRYPLTVDHPEAGDRLSSETGSDAFEEFLDRQDDLSQHVQDYQLYQAIQKLTDKQKSVLTKVYLHGATMQEIADSLGESRQNISNIHKKGLENIRKQLAAQKKGEK 70B869300CFAE709 rpoc_bacsu DNA-directed RNA polymerase subunit beta' lpm std RNA polymerase subunit beta' Transcriptase subunit beta' BSU01080 rpoC protein protein bacsu Bacillus subtilis MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYGNKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITEEERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMANPAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQEIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMMKYRKVKPVSNVQPTDDMVPVE 33263510698FC12B rsoa_bacsu Sigma-O factor regulatory protein RsoA rsoA yvrHa BSU33222 protein protein bacsu Bacillus subtilis MDGQFEQKKKQKDETYDIEHLIACFSPMIRKKLSNTSYQEREDLEQELKIKMFEKADMLLCQDVPGFWEFILYMVDENS 675BBF77D37C088F rnap_beta-yvri-1 3199388 N/A 3199395 unspecified role unspecified role bait bait Beta-flap domain Region 817-896 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P37870:p.Ile864Lys I864K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P37870:p.Phe865Lys F865K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199396 unspecified role unspecified role prey prey C-terminal domain Region 110-161 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnap_beta'-yvrha-1 3199389 N/A 3199397 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false baciu Bacillus subtilis N/A 3199398 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false baciu Bacillus subtilis N/A 3199396 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false baciu Bacillus subtilis association association false false false rnap_beta'-yvrha-2 3199390 N/A 3199397 unspecified role unspecified role bait bait Region 1-303 Region 1-303 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P37871:p.Arg264Gln R264Q mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P37871:p.Ala291Asp A291D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199398 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false yvri-yvrha-1 3199391 N/A 3199398 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3199396 unspecified role unspecified role bait bait N-terminal domain Region 3-79 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnap_beta'-yvrha-3 3199392 N/A 3199397 unspecified role unspecified role bait bait Region 1-303 Region 1-303 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199398 unspecified role unspecified role prey prey C0H3R4:p.Leu44Ala L44E/A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Gln46Ala Q46E/A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Asp43Ala D43A/N mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Arg41Ala R41A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Leu44Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Gln46Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false C0H3R4:p.Asp43Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false yvrha-yvri-1 3199393 N/A 3199398 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3199396 unspecified role unspecified role prey prey N-terminal domain Region 3-79 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false yvri-1 3199394 N/A 3199396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false