DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schmaier-2009-1 in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216432X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216421X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-3 in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216430X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216426X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-5 in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216424X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-6 in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216428X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216422X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-8 in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216431X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216425X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-10 in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216429X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-11 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216423X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation schmaier-2009-12 in vitro In vitro phage display phage display predetermined predetermined participant predetermined Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. DIP original experiment: DIP-216427X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular priming of Lyn by GPVI enables an immune receptor to adopt a hemostatic role. Schmaier AA., Zou Z., Kazlauskas A., Emert-Sedlak L., Fong KP., Neeves KB., Maloney SF., Diamond SL., Kunapuli SP., Ware J., Brass LF., Smithgall TE., Saksela K., Kahn ML. Only protein-protein interactions imex curation itsn1_human Intersectin-1 SH3 domain-containing protein 1A SH3P17 ITSN1 ITSN SH3D1A protein protein human Homo sapiens Human MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP q9hcn6-1 Platelet glycoprotein VI GP6 Glycoprotein 6 VI-1 protein protein human Homo sapiens Human MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP gpvi_human Platelet glycoprotein VI GP6 Glycoprotein 6 protein protein human Homo sapiens Human MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL hck_human Tyrosine-protein kinase HCK HCK Hemopoietic cell kinase p59-HCK/p60-HCK Hematopoietic cell kinase p59Hck p61Hck protein protein human Homo sapiens Human MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP crkl_human Crk-like protein CRKL protein protein human Homo sapiens Human MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE btk_human Tyrosine-protein kinase BTK Bruton tyrosine kinase B-cell progenitor kinase BPK BTK AGMX1 ATK Agammaglobulinemia tyrosine kinase protein protein human Homo sapiens Human MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES gp6-itsn1-1 3199306 N/A 3199318 unspecified role unspecified role prey prey SH3-3 domain Region 1002-1060 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-lyn-1 3199307 N/A 3199320 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3199321 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false gp6-yes1-1 3199308 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199322 unspecified role unspecified role prey prey SH3 domain Region 91-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-lyn-2 3199309 N/A 3199320 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3199321 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false gp6-fyn-1 3199310 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199323 unspecified role unspecified role prey prey SH3 domain Region 82-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-hck-1 3199311 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199324 unspecified role unspecified role prey prey SH3 domain Region 78-138 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-lyn-3 3199312 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3199320 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false gp6-crkl-1 3199313 N/A 3199325 unspecified role unspecified role prey prey SH3 domain Region 123-296 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-fyn-2 3199314 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3199323 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false gp6-btk-1 3199315 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199326 unspecified role unspecified role prey prey SH3 domain Region 214-274 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false gp6-fyn-3 3199316 N/A 3199320 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3199323 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3199321 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false gp6-lyn-4 3199317 N/A 3199319 unspecified role unspecified role bait bait Cytoplasmic tail domain Region 289-339 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3199320 unspecified role unspecified role prey prey SH3 domain Region 63-123 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false