DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2009-49 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wang J., Pielak RM., McClintock MA., Chou JJ. DIP original experiment: DIP-133334X Nature structural & molecular biology 2009 IMEx Solution structure and functional analysis of the influenza B proton channel. Wang J., Pielak RM., McClintock MA., Chou JJ. Only protein-protein interactions imex curation wang-2009-50 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang J., Pielak RM., McClintock MA., Chou JJ. DIP original experiment: DIP-133337X Nature structural & molecular biology 2009 IMEx Solution structure and functional analysis of the influenza B proton channel. Wang J., Pielak RM., McClintock MA., Chou JJ. Only protein-protein interactions imex curation wang-2009-51 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wang J., Pielak RM., McClintock MA., Chou JJ. DIP original experiment: DIP-133338X Nature structural & molecular biology 2009 IMEx Solution structure and functional analysis of the influenza B proton channel. Wang J., Pielak RM., McClintock MA., Chou JJ. Only protein-protein interactions imex curation wang-2009-52 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Wang J., Pielak RM., McClintock MA., Chou JJ. DIP original experiment: DIP-133335X Nature structural & molecular biology 2009 IMEx Solution structure and functional analysis of the influenza B proton channel. Wang J., Pielak RM., McClintock MA., Chou JJ. Only protein-protein interactions imex curation wang-2009-53 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Wang J., Pielak RM., McClintock MA., Chou JJ. DIP original experiment: DIP-133336X Nature structural & molecular biology 2009 IMEx Solution structure and functional analysis of the influenza B proton channel. Wang J., Pielak RM., McClintock MA., Chou JJ. Only protein-protein interactions imex curation q5v9a4_9infb BM2 Matrix protein 2 BM2 protein protein influenza b virus (b/maryland/1/2001) influenza b virus (b/maryland/1/2001) MLEPFQILSICSFILSALHFMAWTIGHLNQIKRGVNMKIRIKGPNKETINREVSILRHSYQKEIQAKETMKEVLSDNMEVLSDHIVIEGLSAEEIIKMGETVLEIEELH A7674612B2885380 q5v9a5_9infb Matrix protein 1 M M1 protein protein influenza b virus (b/maryland/1/2001) influenza b virus (b/maryland/1/2001) MSLFGDTIAYLLSLTEDGEGKAELAEKLHCWFGGKEFDLDSALEWIKNKRCLTDVQKALIGASICFLKPKDQERKRRFITEPLSGMGTTATKKKGLILAERKMRRCVSFHEAFEIAEGHESSALLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHSHRAHSRAARSSVPGVRREMQMVSAMNTAKTMNGMGKGEDVQKLAEELQSNIGVLRSLGASQKNGEGIAKDVMEVLKQSSMGNSALVKKYL 69E6035D1A3E3053 bm2-1 3198710 N/A 3198715 unspecified role unspecified role unspecified role unspecified role Channel domain Region 1-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Cytoplasmic domain Region 26-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bm2-2 3198711 N/A 3198715 unspecified role unspecified role unspecified role unspecified role Cytoplasmic domain Region 43-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bm1-bm2-1 3198712 N/A 3198716 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3198715 unspecified role unspecified role unspecified role unspecified role Cytoplasmic domain Region 43-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bm2-3 3198713 N/A 3198715 unspecified role unspecified role unspecified role unspecified role Cytoplasmic domain Region 26-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Channel domain Region 1-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bm2-4 3198714 N/A 3198715 unspecified role unspecified role unspecified role unspecified role Channel domain Region 1-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false