DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nojiri-2009-1 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. DIP original experiment: DIP-219599X Nature 2009 IMEx Structural basis of inter-protein electron transfer for nitrite reduction in denitrification. Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. Only protein-protein interactions imex curation nojiri-2009-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. DIP original experiment: DIP-219600X Nature 2009 IMEx Structural basis of inter-protein electron transfer for nitrite reduction in denitrification. Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. Only protein-protein interactions imex curation nojiri-2009-3 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. DIP original experiment: DIP-219601X Nature 2009 IMEx Structural basis of inter-protein electron transfer for nitrite reduction in denitrification. Nojiri M., Koteishi H., Nakagami T., Kobayashi K., Inoue T., Yamaguchi K., Suzuki S. Only protein-protein interactions imex curation d0vwq8_alcxx protein protein achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans AADAPAQLDPAGEKLYRSACVVCHASGVANAPKLGDKQAWAPFLAQGADALLATVLKGKGAMPPRGGTAADEATLRAAVAYMMDAAR o68601_alcxx Copper-containing nitrite reductase nirK ERS451415_02178 nir I6G72_25870 protein protein achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans MNALRPTLLAAALAFTMAAGTAWAQDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR d0vwq8_alcxx-nir-1 3198479 N/A 3198482 electron donor electron donor unspecified role unspecified role achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans N/A 3198483 electron acceptor electron acceptor unspecified role unspecified role achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false d0vwq8_alcxx-nir-2 3198480 N/A 3198482 unspecified role unspecified role unspecified role unspecified role achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans N/A 3198483 unspecified role unspecified role unspecified role unspecified role achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans direct interaction direct interaction false false false d0vwq8_alcxx-nir-3 3198481 N/A 3198482 electron donor electron donor unspecified role unspecified role achromobacter xylosoxidans Alcaligenes xylosoxydans xylosoxydans Achromobacter xylosoxidans N/A 3198483 electron acceptor electron acceptor unspecified role unspecified role ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false