DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ levin-2009-8 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Levin EJ., Quick M., Zhou M. DIP original experiment: DIP-254228X Nature 2009 IMEx Crystal structure of a bacterial homologue of the kidney urea transporter. Levin EJ., Quick M., Zhou M. Only protein-protein interactions imex curation levin-2009-9 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Levin EJ., Quick M., Zhou M. DIP original experiment: DIP-254229X Nature 2009 IMEx Crystal structure of a bacterial homologue of the kidney urea transporter. Levin EJ., Quick M., Zhou M. Only protein-protein interactions imex curation ut_desvh Urea transporter DVU1160 DVU_1160 protein protein desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) MFGEQLLKNPLIEFCDSVCRGCGQVMFQNNTVTGLLFFAGIFYNSTTLGVCAVLGTAASTLTAQLLGVDKPLVRAGLFGFNGTLAGIALPFFFNYEPAMLGYVALNGAFTTIIMASLLNFLGKWGVPALTAPFVLATWLLMFGVYKLSLFHPGALIAPALPSVAGLADMGTVTGRTFMEGLFKGVGEVMFQDNIVTGVIFVVAILVNSRISALFAVIGSLVGLCTALIMHSPETPVRLGLYGFNSVLCGIAMGGIFFYLNIRTFLYALGCMVLGAIATGAFSVLLSPIGMPALTWPFIVVTWLFLFAGSMFRNIAQVPTEKAGTPEDNLRSLAIGSR The Uniprot ID was selected from the closely mapped strain from the sequence provided in the paper. BB578918E1BDC9CA dvut-1 3198178 N/A 3198180 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dvut-2 3198179 N/A 3198180 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false