DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2009-9 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134698X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-10 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134696X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-11 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134699X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-12 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134701X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-13 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134697X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-14 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134702X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation liu-2009-15 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. DIP original experiment: DIP-134700X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx HPV E6 protein interacts physically and functionally with the cellular telomerase complex. Liu X., Dakic A., Zhang Y., Dai Y., Chen R., Schlegel R. Only protein-protein interactions imex curation tert_human Telomerase reverse transcriptase TERT EST2 TCS1 TRT Telomerase catalytic subunit HEST2 Telomerase-associated protein 2 protein protein human Homo sapiens Human MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD ve6_hpv16 Protein E6 E6 protein protein hpv16 Human papillomavirus type 16 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL tert-e6-1 3198017 N/A 3198024 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role prey prey AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false e6-tert-1 3198018 N/A 3198024 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3198025 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false e6-tert-2 3198019 N/A 3198024 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false e6-tert-3 3198020 N/A 3198024 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false e6-tert-4 3198021 N/A 3198024 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role bait bait AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false tert-e6-2 3198022 N/A 3198024 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false tert-e6-3 3198023 N/A 3198024 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3198025 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false