DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ arunkumar-2009-1 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Arunkumar AI., Campanello GC., Giedroc DP. DIP original experiment: DIP-134677X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of a paradigm ArsR family zinc sensor in the DNA-bound state. Arunkumar AI., Campanello GC., Giedroc DP. Only protein-protein interactions imex curation arunkumar-2009-2 ecolx Escherichia coli fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Arunkumar AI., Campanello GC., Giedroc DP. DIP original experiment: DIP-134678X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of a paradigm ArsR family zinc sensor in the DNA-bound state. Arunkumar AI., Campanello GC., Giedroc DP. Only protein-protein interactions imex curation o85142_staau A6762_10880 BSG37_11590 BTN44_13085 DQU54_12245 ELP52_12150 FAF32_013990 FPP26_11935 G6X37_02945 GO810_03130 GO942_06145 GQX37_08730 RK64_11395 SAGV51_02491 SAGV69_02587 SAHC1335_00090 SAMEA1029536_01563 SAMEA103891420_02659 rzcA CzrA czrA SAMEA103891454_01118 SAMEA2076468_01945 SAMEA2076503_02191 SAMEA2077334_01954 SAMEA2078260_01939 SAMEA2079501_02004 SAMEA2080344_01776 SAMEA2081063_01791 SAMEA4008569_02042 SAMEA70146418_02191 A2U18_11180 CV021_10345 E3A28_11675 E3K14_11465 E4U00_11890 E5491_12095 GO814_05535 GZ145_05725 QU38_06130 SAMEA2078588_01910 czrA_2 C7P97_10450 CSC87_01140 DD547_02180 EP54_06885 EQ90_13065 FA040_09705 G6X35_09305 G6Y24_05035 GO788_11315 GO793_16165 GO941_16585 GZ128_05185 HMPREF3211_00009 NCTC10654_02308 NCTC10702_03381 NCTC5664_01801 NCTC6133_02909 NCTC7878_02904 SA0759_03261 SA950122_03126 BN1321_350009 SAMEA70245418_02324 protein protein staau Staphylococcus aureus MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL rzca-1 3197543 N/A 3197545 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rzca-2 3197544 N/A 3197545 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false