DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ davis-2009-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. DIP original experiment: DIP-132682X PLoS biology 2009 IMEx Capzb2 interacts with beta-tubulin to regulate growth cone morphology and neurite outgrowth. Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. Only protein-protein interactions imex curation davis-2009-4 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. DIP original experiment: DIP-132685X PLoS biology 2009 IMEx Capzb2 interacts with beta-tubulin to regulate growth cone morphology and neurite outgrowth. Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. Only protein-protein interactions imex curation davis-2009-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. DIP original experiment: DIP-132683X PLoS biology 2009 IMEx Capzb2 interacts with beta-tubulin to regulate growth cone morphology and neurite outgrowth. Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. Only protein-protein interactions imex curation davis-2009-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. DIP original experiment: DIP-132684X PLoS biology 2009 IMEx Capzb2 interacts with beta-tubulin to regulate growth cone morphology and neurite outgrowth. Davis DA., Wilson MH., Giraud J., Xie Z., Tseng HC., England C., Herscovitz H., Tsai LH., Delalle I. Only protein-protein interactions imex curation capzb_mouse F-actin-capping protein subunit beta Capzb Cappb1 CapZ beta protein protein mouse Mus musculus Mouse MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSLDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN tbb3_mouse Tubulin beta-3 chain Tubb3 protein protein mouse Mus musculus Mouse MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDDEESEAQGPK p47757-2 F-actin-capping protein subunit beta Capzb CapZ beta Cappb1 protein protein mouse Mus musculus Mouse MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC caza2_mouse F-actin-capping protein subunit alpha-2 Capza2 Cappa2 CapZ alpha-2 protein protein mouse Mus musculus Mouse MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAIESWRTSVETALRAYVKEHYPNGVCTVYGKKVDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTVTPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA tubb3-capzb-1 3197222 N/A 3197226 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3197227 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false capza2-capzb-1 3197223 N/A 3197228 unspecified role unspecified role unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3197229 unspecified role unspecified role unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false capzb-tubb3-1 3197224 N/A 3197226 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3197227 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false capzb-tubb3-2 3197225 N/A 3197228 unspecified role unspecified role bait bait Region 106-140 Region 106-140 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3197227 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false