DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ langereis-2009-1 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Langereis MA., Zeng Q., Gerwig GJ., Frey B., von Itzstein M., Kamerling JP., de Groot RJ., Huizinga EG. DIP original experiment: DIP-134500X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases. Langereis MA., Zeng Q., Gerwig GJ., Frey B., von Itzstein M., Kamerling JP., de Groot RJ., Huizinga EG. Only protein-protein interactions imex curation langereis-2009-2 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Langereis MA., Zeng Q., Gerwig GJ., Frey B., von Itzstein M., Kamerling JP., de Groot RJ., Huizinga EG. DIP original experiment: DIP-134501X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases. Langereis MA., Zeng Q., Gerwig GJ., Frey B., von Itzstein M., Kamerling JP., de Groot RJ., Huizinga EG. Only protein-protein interactions imex curation q70kp4_9nido Sialate O-acetylesterase HE protein protein porcine torovirus Porcine torovirus MLRMRVRPPGAILIFVLLPLVLTSKPITPHYGPGHITPDWCGFGDSRSDCGNKHTPKSLDIPQELCPKFSSRTGSSMFISMHWNNGSGFDAFDYSNCGVEKVFYEGVNFSPHRNYTCYQEGSSGWVSNKVGFYSKLYSMASTSRCIKLINLDPPTNFTNYRNGTCVGNGGTAKMPDNPQLVIFDAVTKLSTQFVLPNSSDGVSCTKHLVPFCYIDGGCFEMSGVCHPFGYYYESPSFYHGFYTNGTAGLHSYICDYLEMKPGVYNATTFGKFLIYPTKSYCMDTMNYTVPVQAVQSIWSENRQSDDAIGQACKSPYCIFYNKTKPYLAPNGADENHGDEEVRQMMQGLLVNSSCVSPQGSTPLALYSSEMIYIPNYGSCPQYYKLFETSSDENVDVTSSAYFVATWVLLVLVIILVFILISFCLSSY hema_brv1 Hemagglutinin-esterase HE E3 glycoprotein protein protein brv1 Breda virus 1 BRV-1 MLSLILFFPSFAFAATPVTPYYGPGHITFDWCGFGDSRSDCTNPQSPMSLDIPQQLCPKFSSKSSSSMFLSLHWNNHSSFVSYDYFNCGVEKVFYEGVNFSPRKQYSCWDEGVDGWIELKTRFYTKLYQMATTSRCIKLIQLQAPSSLPTLQAGVCRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTTICTKHLVPFCYLNHGCFTTGGSCLPFGVSYVSDSFYYGYYDATPQIGSTESHDYVCDYLFMEPGTYNASTVGKFLVYPTKSYCMDTMNITVPVQAVQSIWSEQYASDDAIGQACKAPYCIFYNKTTPYTVTNGSDANHGDDEVRMMMQGLLRNSSCISPQGSTPLALYSTEMIYEPNYGSCPQFYKLFDTSGNENIDVISSSYFVATWVLLVVVVILIFVIISFFC he-4 3195979 N/A 3195981 unspecified role unspecified role unspecified role unspecified role Region 24-393 Region 24-393 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false he-5 3195980 N/A 3195982 unspecified role unspecified role unspecified role unspecified role Region 15-392 Region 15-392 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false