DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2009-28 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. DIP original experiment: DIP-134450X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Galectin-3 negatively regulates TCR-mediated CD4+ T-cell activation at the immunological synapse. Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. Only protein-protein interactions imex curation chen-2009-29 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. DIP original experiment: DIP-134453X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Galectin-3 negatively regulates TCR-mediated CD4+ T-cell activation at the immunological synapse. Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. Only protein-protein interactions imex curation chen-2009-30 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. DIP original experiment: DIP-134451X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Galectin-3 negatively regulates TCR-mediated CD4+ T-cell activation at the immunological synapse. Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. Only protein-protein interactions imex curation chen-2009-31 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. DIP original experiment: DIP-134452X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Galectin-3 negatively regulates TCR-mediated CD4+ T-cell activation at the immunological synapse. Chen HY., Fermin A., Vardhana S., Weng IC., Lo KF., Chang EY., Maverakis E., Yang RY., Hsu DK., Dustin ML., Liu FT. Only protein-protein interactions imex curation q9wu78-1 Programmed cell death 6-interacting protein Pdcd6ip Aip1 Alix ALG-2-interacting protein 1 ALG-2-interacting protein X E2F1-inducible protein Eig2 protein protein mouse Mus musculus Mouse MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTSVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVVSVLKSLLSNLDEIKKERESLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRIYGGLTSKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPPPAYQSSPAAGHAAAPPTPAPRTMPPAKPQPPARPPPPVLPANRVPPASAAAAPAGVGTASAAPPQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPTYPFPQPPQQSYYPQQ leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ pdcd6ip-lgals3-1 3195771 N/A 3195775 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3195776 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lgals3-pdcd6ip-1 3195772 N/A 3195777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3195776 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false pdcd6ip-lgals3-2 3195773 N/A 3195777 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3195776 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lgals3-pdcd6ip-2 3195774 N/A 3195775 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3195776 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false