DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ suloway-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. DIP original experiment: DIP-134478X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model for eukaryotic tail-anchored protein binding based on the structure of Get3. Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. Only protein-protein interactions imex curation suloway-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. DIP original experiment: DIP-134479X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model for eukaryotic tail-anchored protein binding based on the structure of Get3. Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. Only protein-protein interactions imex curation suloway-2009-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. DIP original experiment: DIP-134480X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model for eukaryotic tail-anchored protein binding based on the structure of Get3. Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. Only protein-protein interactions imex curation suloway-2009-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. DIP original experiment: DIP-134481X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model for eukaryotic tail-anchored protein binding based on the structure of Get3. Suloway CJ., Chartron JW., Zaslaver M., Clemons WM. Only protein-protein interactions imex curation get3_aspfu ATPase get3 get3 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Golgi to ER traffic protein 3 Guided entry of tail-anchored proteins 3 AFUA_3G11350 protein protein aspfu Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) Aspergillus fumigatus MSSTAVVHGDDLMEPTLQSILSQKTLRWIFVGGKGGVGKTTTSCSLAIQLAKVRKSVLLISTDPAHNLSDAFGQKFGKEARLVDGYSNLSAMEIDPNGSIQDLLASGDSQGDDPLAGLGMGNMMQDLAFSIPGVDEAMSFAEVLKQVKSLSYEVIVFDTAPTGHTLRFLQFPTVLEKALAKLSQLSSQFGPMLNSILGARGGLPGGQNIDELLQKMESLRETISEVNTQFKNPDMTTFVCVCIAEFLSLYETERMIQELTSYGIDTHAIVVNQLLFPKEGSGCEQCNARRKMQKKYLEQIEELYEDFNVVRMPLLVEEVRGKEKLEKFSEMLVHPYVPPQ 9F6B277957FFE461 get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 afget3-1 3195654 N/A 3195658 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scget3-3 3195655 N/A 3195659 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false afget3-2 3195656 N/A 3195658 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scget3-4 3195657 N/A 3195659 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false