DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ garca_heras-2009-1 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216095X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation garca_heras-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216098X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation garca_heras-2009-3 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216096X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation garca_heras-2009-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216099X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation garca_heras-2009-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216100X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation garca_heras-2009-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. DIP original experiment: DIP-216097X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Functional equivalence of HMGA- and histone H1-like domains in a bacterial transcriptional factor. García-Heras F., Padmanabhan S., Murillo FJ., Elías-Arnanz M. Only protein-protein interactions imex curation q50888_myxxa BHS06_26425 carG HK404_15530 protein protein myxxa Myxococcus xanthus MIRVVTLDPFDDKQLAKFNRTLYTAFGVGSEHSDSVEVPAGMSEPLDAEKLIDEVKGIRSYKDDKVLLLTTRKLKDRELPSGVAPTAGFARQGKDRAILTIAPHKDLESAFKAVSRHALHQLGHLWELHHCLDPRCSMYPPWTPSFAQGEAIFCTFCREKSEQKIRLAKS q50887_myxxa carD HK404_15535 protein protein myxxa Myxococcus xanthus MPEGSASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIGVRKVASAEDVEAIFTFLRSDSDKADLDWKQRARTNLDRMTQGGIMGLAEVVKGLQVLSELRPLPTKERELYDNARHLLVTEVAAALGTAEVNAEDAIDIVLFPPGRERPKRTAAEFQREEGDLDLDSDLLGLDSDLDLPSDEEPSEPSEEESSEEGESEEAASSEESAPKKRGRPPKAKTEAPEGAEPPAPKKRGRPPKPKPEATAEGAEPPAPKKRGRPPKPKPPEVEGAAPAAPKKRGRPPKVKPPEGES q2idh1_anade Adeh_2858 protein protein anade Anaeromyxobacter dehalogenans (strain 2CP-C) MIRVVTLDPVDPTDMAALIRTLYQAFGLGTEFAGEKPVPAEAEGKDGRLDAITLLREVEPVRTFADDKVLYIAGAPLSLPPGPLGEPPCWGFADYGKERAVITTAKLPARGVTEASIETYRRRLAREAIHAIGHLWDLHHCVDARCAMHPSWSPSLAANPDSDLCTFCREKSERKIRLAKT q2idh2_anade Adeh_2857 protein protein anade Anaeromyxobacter dehalogenans (strain 2CP-C) MRGPPARHPNDDAREQLPAPEGIIGIADELKPGDRVVYPNQGVCAVVGWEVKDIAGQKLELVRMTREEDGAAVMVPKGKVPSIGLRRVATGAQMEGVFHYLGAVYDDPELDWKIRHRDNADRLIAGGVLGVAEVVKGLHSLSRLRPLPTKEREQYDNARHLLVHEVSVSLAVPPGLAEDYIDYALMPPAGVKFDLKPPPAPVPLPSRPKKRRVVEEAEEGDLGLGDLGLGDLGIDLEGALEGAEVPGAEAEGAEGAEAGEGEAAGAEGVEAIPGVEEAAPEELPEAEEPVAEEEPEELPVRAPRAAKPARTAEKPGKVEKPEKAAEKKAARPAKPKKAEPEKPAKVEKHAEKPAARKAAAEKPAPAKKAAAKKPAAPKKAPAKKPAAEKPAAKRGGKKK card-carg-1 3194972 N/A 3194978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194979 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false card-1 3194973 N/A 3194979 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q2idh1_anade-q2idh2_anade-1 3194974 N/A 3194980 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194981 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-210 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false card-carg-2 3194975 N/A 3194978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194979 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q2idh2_anade-1 3194976 N/A 3194981 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q2idh1_anade-q2idh2_anade-2 3194977 N/A 3194980 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194981 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false