DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ quinternet-2009-1 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132036X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132034X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132037X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132035X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation a0a425ba78_neime Thiol:disulfide interchange protein DsbD dsbD Protein-disulfide reductase COH33_03365 protein protein neime Neisseria meningitidis MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDEPASAKDRFLQPSSQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKARAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSGGKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYAFGFILLAVAVYLATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHHFLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADWCISCKEMAAYTLNQPEVHQAVDMERFFQIDVTANTPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR The sequence has been withdrawn from uniprot. o30390_neime Peptide-methionine (S)-S-oxide reductase pilB protein protein neime Neisseria meningitidis MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLPAAASGAWKPISNASTAWLTRYPYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYCHID dsbd-pilb-1 3193977 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false dsbd-pilb-2 3193978 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dsbd-pilb-3 3193979 N/A 3193981 electron donor electron donor unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 electron acceptor electron acceptor unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false dsbd-pilb-4 3193980 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false