DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stauch-2009-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Stauch B., Hofmann H., Perkovic M., Weisel M., Kopietz F., Cichutek K., Münk C., Schneider G. DIP original experiment: DIP-134368X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model structure of APOBEC3C reveals a binding pocket modulating ribonucleic acid interaction required for encapsidation. Stauch B., Hofmann H., Perkovic M., Weisel M., Kopietz F., Cichutek K., Münk C., Schneider G. Only protein-protein interactions imex curation stauch-2009-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Stauch B., Hofmann H., Perkovic M., Weisel M., Kopietz F., Cichutek K., Münk C., Schneider G. DIP original experiment: DIP-134369X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model structure of APOBEC3C reveals a binding pocket modulating ribonucleic acid interaction required for encapsidation. Stauch B., Hofmann H., Perkovic M., Weisel M., Kopietz F., Cichutek K., Münk C., Schneider G. Only protein-protein interactions imex curation abc3c_human DNA dC->dU-editing enzyme APOBEC-3C APOBEC1-like Phorbolin I APOBEC3C APOBEC1L PBI protein protein human Homo sapiens Human MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ p89903_sivta Gag polyprotein gag protein protein simian immunodeficiency virus - agm.tan-1 Simian immunodeficiency virus - agm.tan-1 MGAGHSALSGRNLDTFEKIRLRPNGKKKYQLKHLIWAGKKMERFGLHEKLLETKEGCQKIIEVLSPLEPTGSEGLKSLFNLCCVIWCIHAEQKVKDTEEAVVLVKQRCHLVEKEKTAAAPSGGQQQNYNTAATPSGRHGNYPVVQQNNQWVHTPLSPRTLNAWVKTVEEKRFGAEIVPMFQALSEGCLSYDINQMLNVIGDHQGAMQIIKEVINDEAAQWDITHPPPAGPLPAGQLRDPRGSDIAGTTSSVAEQIEWTFNANPRVDVGRIYRGWVILGLQKCVKMYNPISVLDIRQGAKEPFKDYVDRFYQALRAEQTPQDVKNWMTETLLIQNANPDCKLVLKGLGIHPTLEEMLTACQGVGGPGHKAKLMVEAMQQMQGVNMVQGAPRGGRGRGRGPPRCFKCGQIGHIQKDCPRAGPNKCLKCGKPGHLAKDCRSGQANFLGRMPTWGTKPRNFLEQGGAVPTAPPMPAHGFPTGSPAAGAYDPARKLLEQYAKKGDQLRKQKEKELEDYSLSSLFGGDQ gag-apobec3c-1 3193795 N/A 3193797 unspecified role unspecified role prey prey Q9NRW3:p.Arg122Ala R122A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3193798 unspecified role unspecified role bait bait Nucleocapsid protein Region 157-363 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false apobec3c-apobec3c-1 3193796 N/A 3193797 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3193797 unspecified role unspecified role bait bait Q9NRW3:p.Phe55Ala F55A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NRW3:p.Trp74Ala W74A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false