DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bishop-2009-1 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133093X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133098X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-3 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133100X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133094X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133096X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133099X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-7 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133101X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133095X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation bishop-2009-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. DIP original experiment: DIP-133097X Nature structural & molecular biology 2009 IMEx Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP. Bishop B., Aricescu AR., Harlos K., O'Callaghan CA., Jones EY., Siebold C. Only protein-protein interactions imex curation q96qv1-1 Hedgehog-interacting protein HHIP HIP UNQ5825/PRO19644 protein protein human Homo sapiens Human MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV dhh_human Desert hedgehog protein HHG-3 DHH protein protein human Homo sapiens Human MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG shh_mouse Sonic hedgehog protein HHG-1 Shh Hhg1 Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains protein protein mouse Mus musculus Mouse MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQRVYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEARGAEPTAGIHWYSQLLYHIGTWLLDSETMHPLGMAVKSS hhip-1 3193450 N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 56-670 Region 56-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false hhip-dhh-2 3193451 N/A 3193460 unspecified role unspecified role prey prey Region 39-194 Region 39-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193459 unspecified role unspecified role bait bait Region 214-670 Region 214-670 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false hhip-shh-6 3193452 N/A 3193461 unspecified role unspecified role unspecified role unspecified role Region 40-194 Region 40-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false hhip-shh-7 3193453 N/A 3193461 unspecified role unspecified role unspecified role unspecified role Region 40-194 Region 40-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false dhh-hhip-1 3193454 N/A 3193460 unspecified role unspecified role unspecified role unspecified role Region 39-194 Region 39-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false hhip-shh-8 3193455 N/A 3193461 unspecified role unspecified role prey prey Region 40-194 Region 40-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3193459 unspecified role unspecified role bait bait Q96QV1-1:p.Asp383Arg D383R/A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Region 214-670 Region 214-670 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q96QV1-1:p.Asp383Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false dhh-hhip-2 3193456 N/A 3193460 unspecified role unspecified role unspecified role unspecified role Region 39-194 Region 39-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false hhip-shh-9 3193457 N/A 3193461 unspecified role unspecified role unspecified role unspecified role Region 40-194 Region 40-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false dhh-hhip-3 3193458 N/A 3193460 unspecified role unspecified role unspecified role unspecified role Region 39-194 Region 39-194 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193459 unspecified role unspecified role unspecified role unspecified role Region 214-670 Region 214-670 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false