DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ carrano-2009-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Carrano AC., Liu Z., Dillin A., Hunter T. DIP original experiment: DIP-219532X Nature 2009 IMEx A conserved ubiquitination pathway determines longevity in response to diet restriction. Carrano AC., Liu Z., Dillin A., Hunter T. Only protein-protein interactions imex curation carrano-2009-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Carrano AC., Liu Z., Dillin A., Hunter T. DIP original experiment: DIP-219533X Nature 2009 IMEx A conserved ubiquitination pathway determines longevity in response to diet restriction. Carrano AC., Liu Z., Dillin A., Hunter T. Only protein-protein interactions imex curation wwp1_caeel E3 ubiquitin-protein ligase wwp-1 wwp-1 Y65B4BR.4 protein protein caeel Caenorhabditis elegans MARNEPSSQQPSSSGSNGTPAQQNGSAKPSKVTVKVVNASFTKAADCYVEITSDTSSAAPKKTTVKKKTMAPEWNEHLNVHANESSTISFRLLQKAKLFDDTCLGMAKLKLSSLTRNENGEFKNDINNISLLAKDSSKIGTLNIIFSGYPERKRRSAGVRAETAASASSEASTSNGVATSSSARRPATAKRDTLAAPTSTAAAAAAATAGGTPAAGAEEQLPDGWEMRFDQYGRKYYVDHTTKSTTWERPSTQPLPQGWEMRRDPRGRVYYVDHNTRTTTWQRPTADMLEAHEQWQSGRDQAMLQWEQRFLLQQNNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGFRGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVPNHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE ubc18_caeel Ubiquitin-conjugating enzyme E2 ubc-18 ubc-18 R01H2.6 protein protein caeel Caenorhabditis elegans MSATRRLQKELGDLKNCGVKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVDYPFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHPIRADVAEEFQKDHKKFMKTAEEHTRKHAEKRPE ubiq_caeel Ubiquitin ubq-1 ubia F25B5.4 ubq-2 ubib ZK1010.1 protein protein caeel Caenorhabditis elegans MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG wwp_1-ubc_18-1 3193278 N/A 3193280 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3193281 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse physical association physical association false false false ub-ubc_18-1 3193279 N/A 3193281 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3193282 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli covalent binding covalent binding false false false