IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brandt-2009-1 human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. It is not stated if Biotinylated NKp30-Fc has a mouse or human Fc tag, nor is it stated if NKp30-Fc was expressed from 293 or CHO cells. bis(sulfosuccinimidyl) suberate as cross-linker. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr The Journal of experimental medicine 2009 imex curation Only protein-protein interactions brandt-2009-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD., Brandt CS., Baratin M., Yi EC., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander CD., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin SD. NKp30 has been assumed to be of Human origin as no Mouse protein can be found in UniProt or NCBI databases;NCR3 is a nonexpressed pseudogene in most mouse strains. levins@zgi.com,vivier@ciml.univ-mrs.fr The Journal of experimental medicine 2009 imex curation Only protein-protein interactions nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG ncr3-ncr3lg1-3 2969490 N/A 2969492 unspecified role unspecified role neutral component neutral component N/A 2969493 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Text above Fig 2 ncr3-ncr3lg1-4 2969491 N/A 2969492 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969493 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2969505 2969503 direct interaction direct interaction false false false Fig 2 A/D