DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ acharya-2009-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. DIP original experiment: DIP-260315X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Yeast Rev1 protein promotes complex formation of DNA polymerase zeta with Pol32 subunit of DNA polymerase delta. Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. Only protein-protein interactions imex curation acharya-2009-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. DIP original experiment: DIP-260313X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Yeast Rev1 protein promotes complex formation of DNA polymerase zeta with Pol32 subunit of DNA polymerase delta. Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. Only protein-protein interactions imex curation acharya-2009-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. DIP original experiment: DIP-260317X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Yeast Rev1 protein promotes complex formation of DNA polymerase zeta with Pol32 subunit of DNA polymerase delta. Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. Only protein-protein interactions imex curation acharya-2009-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. DIP original experiment: DIP-260316X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Yeast Rev1 protein promotes complex formation of DNA polymerase zeta with Pol32 subunit of DNA polymerase delta. Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. Only protein-protein interactions imex curation acharya-2009-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. DIP original experiment: DIP-260314X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Yeast Rev1 protein promotes complex formation of DNA polymerase zeta with Pol32 subunit of DNA polymerase delta. Acharya N., Johnson RE., Pagès V., Prakash L., Prakash S. Only protein-protein interactions imex curation rev1_yeast DNA repair protein REV1 REV1 YOR346W O6339 Reversionless protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGEHGGLVDLLDSDLEYSINRETPDKNNCLSQQSVNDSHLTAKTGGLNARSFLSTLSDDSLIEYVNQLSQTNKNNSNPTAGTLRFTTKNISCDELHADLGGGEDSPIARSVIEIQESDSNGDDVKKNTVYTREAYFHEKAHGQTLQDQILKDQYKDQISSQSSKIFKNCVIYINGYTKPGRLQLHEMIVLHGGKFLHYLSSKKTVTHIVASNLPLKKRIEFANYKVVSPDWIVDSVKEARLLPWQNYSLTSKLDEQQKKLDNCKTVNSIPLPSETSLHKGSKCVGSALLPVEQQSPVNLNNLEAKRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDFKRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPISIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSSFKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLSIDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEFGIIATEMKSLYRTLGCPPMELRGLALQFNKLVDVGPDNNQLKLRLPFKTIVTNRAFEALPEDVKNDINNEFEKRNYKRKESGLTSNSLSSKKKGFAISRLEVNDLPSTMEEQFMNELPTQIRAEVRHDLRIQKKIQQTKLGNLQEKIKRREESLQNEKNHFMGQNSIFQPIKFQNLTRFKKICQLVKQWVAETLGDGGPHEKDVKLFVKYLIKLCDSNRVHLVLHLSNLISRELNLCAFLNQDHSGFQTWERILLNDIIPLLNRNKHTYQTVRKLDMDFEV 330E30A27F8300BE dpod3_yeast DNA polymerase delta subunit 3 POL32 J1626 YJR043C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVTKRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK D0B9CC52F26E20B2 rev7_yeast DNA polymerase zeta processivity subunit REV7 Revertibility protein 7 YIL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQFVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVDKDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNRRVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEKLISGDDKILNGVYSQYEEGESIFGSLF 325668130CD13259 dpoz_yeast DNA polymerase zeta catalytic subunit REV3 Protein reversionless 3 PSO1 P2535 YPL167C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRESNDTIQSDTVRSSSKSDYFRIQLNNQDYYMSKPTFLDPSHGESLPLNQFSQVPNIRVFGALPTGHQVLCHVHGILPYMFIKYDGQITDTSTLRHQRCAQVHKTLEVKIRASFKRKKDDKHDLAGDKLGNLNFVADVSVVKGIPFYGYHVGWNLFYKISLLNPSCLSRISELIRDGKIFGKKFEIYESHIPYLLQWTADFNLFGCSWINVDRCYFRSPVLNSILDIDKLTINDDLQLLLDRFCDFKCNVLSRRDFPRVGNGLIEIDILPQFIKNREKLQHRDIHHDFLEKLGDISDIPVKPYVSSARDMINELTMQREELSLKEYKEPPETKRHVSGHQWQSSGEFEAFYKKAQHKTSTFDGQIPNFENFIDKNQKFSAINTPYEALPQLWPRLPQIEINNNSMQDKKNDDQVNASFTEYEICGVDNENEGVKGSNIKSRSYSWLPESIASPKDSTILLDHQTKYHNTINFSMDCAMTQNMASKRKLRSSVSANKTSLLSRKRKKVMAAGLRYGKRAFVYGEPPFGYQDILNKLEDEGFPKIDYKDPFFSNPVDLENKPYAYAGKRFEISSTHVSTRIPVQFGGETVSVYNKPTFDMFSSWKYALKPPTYDAVQKWYNKVPSMGNKKTESQISMHTPHSKFLYKFASDVSGKQKRKKSSVHDSLTHLTLEIHANTRSDKIPDPAIDEVSMIIWCLEEETFPLDLDIAYEGIMIVHKASEDSTFPTKIQHCINEIPVMFYESEFEMFEALTDLVLLLDPDILSGFEIHNFSWGYIIERCQKIHQFDIVRELARVKCQIKTKLSDTWGYAHSSGIMITGRHMINIWRALRSDVNLTQYTIESAAFNILHKRLPHFSFESLTNMWNAKKSTTELKTVLNYWLSRAQINIQLLRKQDYIARNIEQARLIGIDFHSVYYRGSQFKVESFLIRICKSESFILLSPGKKDVRKQKALECVPLVMEPESAFYKSPLIVLDFQSLYPSIMIGYNYCYSTMIGRVREINLTENNLGVSKFSLPRNILALLKNDVTIAPNGVVYAKTSVRKSTLSKMLTDILDVRVMIKKTMNEIGDDNTTLKRLLNNKQLALKLLANVTYGYTSASFSGRMPCSDLADSIVQTGRETLEKAIDIIEKDETWNAKVVYGDTDSLFVYLPGKTAIEAFSIGHAMAERVTQNNPKPIFLKFEKVYHPSILISKKRYVGFSYESPSQTLPIFDAKGIETVRRDGIPAQQKIIEKCIRLLFQTKDLSKIKKYLQNEFFKIQIGKVSAQDFCFAKEVKLGAYKSEKTAPAGAVVVKRRINEDHRAEPQYKERIPYLVVKGKQGQLLRERCVSPEEFLEGENLELDSEYYINKILIPPLDRLFNLIGINVGNWAQEIVKSKRASTTTTKVENITRVGTSATCCNCGEELTKICSLQLCDDCLEKRSTTTLSFLIKKLKRQKEYQTLKTVCRTCSYRYTSDAGIENDHIASKCNSYDCPVFYSRVKAERYLRDNQSVQREEALISLNDW 54C2C6B664F734F5 pol32-rev1-1 3191846 N/A 3191851 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191852 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rev1-pol32-1 3191847 N/A 3191852 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191851 unspecified role unspecified role bait bait Region 567-767 Region 567-767 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rev3-rev7-1 3191848 N/A 3191853 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191854 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rev3-pol32-1 3191849 N/A 3191853 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191852 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191851 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191854 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pol32-rev1-2 3191850 N/A 3191851 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3191852 unspecified role unspecified role bait bait Region 1-181 Region 1-181 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false