DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mita-2009-1 patpe Patiria pectinifera Starfish Asterina pectinifera reverse phase chrom reverse phase chromatography reverse phase chrom predetermined predetermined participant predetermined Mita M., Yoshikuni M., Ohno K., Shibata Y., Paul-Prasanth B., Pitchayawasin S., Isobe M., Nagahama Y. DIP original experiment: DIP-216074X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A relaxin-like peptide purified from radial nerves induces oocyte maturation and ovulation in the starfish, Asterina pectinifera. Mita M., Yoshikuni M., Ohno K., Shibata Y., Paul-Prasanth B., Pitchayawasin S., Isobe M., Nagahama Y. Only protein-protein interactions imex curation gss_patpe Gonad-stimulating substance GSS RGP Relaxin-like gonad-stimulating peptide protein protein patpe Patiria pectinifera Starfish Asterina pectinifera MTSNNRHLFQATCLVLLLLHAAFHGGALGEKYCDDDFHMAVFRTCAVSKRSQPGMSLSDVLTMNRFRGHNIKRSIDSTLEDNAFFMSGLEKRSEYSGIASYCCLHGCTPSELSVVC gss-gss-6 3191457 N/A 3191458 unspecified role unspecified role unspecified role unspecified role Chain A Region 93-116 polyprotein frag polyprotein fragment polyprotein frag de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain false patpe Patiria pectinifera Starfish Asterina pectinifera N/A 3191458 unspecified role unspecified role unspecified role unspecified role Chain B Region 30-48 polyprotein frag polyprotein fragment polyprotein frag de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain false patpe Patiria pectinifera Starfish Asterina pectinifera direct interaction direct interaction false false false