DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lin-2009-5 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216065X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-6 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216068X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-7 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216070X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216066X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-9 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216071X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-10 ecolx Escherichia coli electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216072X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-11 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216067X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-12 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216069X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation lin-2009-13 ecolx Escherichia coli electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Lin Z., Huang W., Zhang J., Fan JS., Yang D. DIP original experiment: DIP-216073X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Solution structure of eggcase silk protein and its implications for silk fiber formation. Lin Z., Huang W., Zhang J., Fan JS., Yang D. Only protein-protein interactions imex curation c5h5c9_9arac protein protein trichonephila antipodiana Trichonephila antipodiana MVWLTSIAFIVTLLGAQYDIVTAQAISVATSVPSVFSSPSLASGFLGCLTTGIGQSPDFPFQEQQDLDDLAQVILSAVTSNTDTSKSARAQALSTALASSLADLLISESSGSSYQTQISALTNILSDCFVTTTGSNNPAFVSRVQTLIAVLSQSSSNAISGATGGSAFAQSQAFQQSASQSAGLSASRAGSTSSSTTTTTSGATSQAASQSASSSYSSAFAQAASSALATSSAISRAFASVSSASAASSLAYNIGLSAARSLGIASDTALAGALAQAVGGVGAGASASAYANAIARAAGQFLATQGVLNAGNASALAGSFARALSASAESQSFAQSQAYQQAS q1i128_9arac protein protein trichonephila antipodiana Trichonephila antipodiana SGATSQAASQSASSSYSSAFAQAASSALATSSAISRAFASVSSASAASSLAYNIGLSAARSLGIASDTALAGALAQAVGGVGAGASASAYANAIARAAGQFLATQGVLNAGNASALAGSFARALSASAESQSFAQSQAYQQASAFQQAAAQSAAQSASRAGSTSSSTTTTTSGATSQAASQSASSSYSSAFAQAASSSLATSSAISRAFASVSSASAASSLAYNIGLSAARSLGIASDTALAGALAQAVGGVGAGASASAYANAIARAAGQFLATQGVLNAVNASSLGSALANALSDSAANSAVSGNYLGVSQNFGRIAPVTGGTAGISVGVPGYLRTPSSTILAPSNAQIISLGLQTTLAPVLSSSGLSSASASARVSSLAQSLASALSTSRGTLSLSTFLNLLSSISSEIRASTSLDGTQATVEVLLEALAALLQVINGAQITDVNVSSVPSVNAALVSALVA c5h5c9_9arac-1 3191018 N/A 3191027 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 63-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c5h5c9_9arac-q1i128_9arac-1 3191019 N/A 3191027 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 63-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3191028 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 305-465 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false RP1 domain Region 1-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false RP2 domain Region 186-314 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c5h5c9_9arac-2 3191020 N/A 3191027 unspecified role unspecified role unspecified role unspecified role Region 24-343 Region 24-343 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c5h5c9_9arac-3 3191021 N/A 3191027 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 63-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q1i128_9arac-1 3191022 N/A 3191028 unspecified role unspecified role unspecified role unspecified role Region 186-465 Region 186-465 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c5h5c9_9arac-4 3191023 N/A 3191027 unspecified role unspecified role unspecified role unspecified role Region 24-343 Region 24-343 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q1i128_9arac-2 3191024 N/A 3191028 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 305-465 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q1i128_9arac-3 3191025 N/A 3191028 unspecified role unspecified role unspecified role unspecified role RP1 domain Region 1-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false RP2 domain Region 186-314 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q1i128_9arac-4 3191026 N/A 3191028 unspecified role unspecified role unspecified role unspecified role Region 186-465 Region 186-465 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false