DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nerelius-2009-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-134255X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alpha-helix targeting reduces amyloid-beta peptide toxicity. Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J., Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J. Only protein-protein interactions imex curation nerelius-2009-2 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J. Alzheimers - Interactions investigated in the context of Alzheimers disease DIP original experiment: DIP-134256X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alpha-helix targeting reduces amyloid-beta peptide toxicity. Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J., Nerelius C., Sandegren A., Sargsyan H., Raunak R., Leijonmarck H., Chatterjee U., Fisahn A., Imarisio S., Lomas DA., Crowther DC., Strömberg R., Johansson J. Only protein-protein interactions imex curation p05067-pro_0000000093 Amyloid-beta protein 40 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 672 711 app-app-99 3191009 N/A 3191011 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3191011 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false app-app-100 3191010 N/A 3191011 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3191011 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false