DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cayrol-2009-1 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260291X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Cayrol C., Girard JP. Only protein-protein interactions imex curation cayrol-2009-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cayrol C., Girard JP. DIP original experiment: DIP-260294X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Cayrol C., Girard JP. Only protein-protein interactions imex curation cayrol-2009-3 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260292X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Cayrol C., Girard JP. Only protein-protein interactions imex curation cayrol-2009-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cayrol C., Girard JP. DIP original experiment: DIP-260293X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-1. Cayrol C., Girard JP. Only protein-protein interactions imex curation o95760-1 Interleukin-33 IL33 C9orf26 IL1F11 NFHEV Interleukin-1 family member 11 Nuclear factor from high endothelial venules protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH il33_human Interleukin-33 Interleukin-1 family member 11 Nuclear factor from high endothelial venules IL33 C9orf26 IL1F11 NFHEV protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET q01638-2 Interleukin-1 receptor-like 1 IL1RL1 DER4 Protein ST2 ST2 T1 ST2S protein protein human Homo sapiens Human MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF il1b_human Interleukin-1 beta IL1B IL1F2 Catabolin protein protein human Homo sapiens Human MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS casp1-il33-1 3190836 N/A 3190840 enzyme target enzyme target substrate substrate unspecified role unspecified role O95760-1:p.Asp178Ala D178A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3190841 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false il1rl1-il33-1 3190837 N/A 3190842 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3190843 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse Mus musculus Mouse physical association physical association false false false casp1-il1b-1 3190838 N/A 3190844 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro In vitro N/A 3190841 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false il1rl1-il33-2 3190839 N/A 3190843 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse Mus musculus Mouse N/A 3190840 unspecified role unspecified role prey prey Region 112-270 Region 112-270 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false