IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kong-2009-2 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Kong Y., Cao W., Xi X., Ma C., Cui L., He W. Interactions involving the chimeric protein TCRgamma9/delta2-OT3-Fc have not been included as the biological relevance of these interactions is unclear, and the exact protein sequences used are not specified. heweiimu@public.bta.net.cn Blood 2009 Only protein-protein interactions imex curation imex curation rae1e_human Retinoic acid early transcript 1E NKG2D ligand 4 Lymphocyte effector toxicity activation ligand RAE-1-like transcript 4 UL16-binding protein 4 RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV klrk1-raet1e-4 3039120 N/A 3039121 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 3039122 unspecified role unspecified role neutral component neutral component n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc physical association physical association false false false 3A