DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lhuillier-2009-1 baciu Bacillus subtilis crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lhuillier S., Gallopin M., Gilquin B., Brasilès S., Lancelot N., Letellier G., Gilles M., Dethan G., Orlova EV., Couprie J., Tavares P., Zinn-Justin S. DIP original experiment: DIP-134226X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating. Lhuillier S., Gallopin M., Gilquin B., Brasilès S., Lancelot N., Letellier G., Gilles M., Dethan G., Orlova EV., Couprie J., Tavares P., Zinn-Justin S. Only protein-protein interactions imex curation hcp16_bpspp Head completion protein gp16 16 Connector protein gp16 Gene product 16 Stopper protein gp16 protein protein bpspp Bacillus phage SPP1 Bacteriophage SPP1 MYEEFPDVITFQSYVEQSNGEGGKTYKWVDEFTAAAHVQPISQEEYYKAQQLQTPIGYNIYTPYDDRIDKKMRVIYRGKIVTFIGDPVDLSGLQEITRIKGKEDGAYVG 16-2 3190548 N/A 3190549 unspecified role unspecified role unspecified role unspecified role O48446:p.Glu45Cys E45C mutation mutation certain certain sequence position certain certain certain sequence position certain false O48446:p.Tyr47Cys Y47C mutation mutation certain certain sequence position certain certain certain sequence position certain false O48446:p.Gln51Cys Q51C mutation mutation certain certain sequence position certain certain certain sequence position certain false O48446:p.[Gln43Cys;Gln51Cys] Q43C/Q51C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false baciu Bacillus subtilis direct interaction direct interaction false false false