DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ han-2009-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260268X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260270X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260277X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260273X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260275X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260276X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260271X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260269X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260274X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation han-2009-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. DIP original experiment: DIP-260272X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities. Han G., Gupta SD., Gable K., Niranjanakumari S., Moitra P., Eichler F., Brown RH., Harmon JM., Dunn TM. Only protein-protein interactions imex curation sptsa_human Serine palmitoyltransferase small subunit A SPTSSA C14orf147 SSSPTA Small subunit of serine palmitoyltransferase A protein protein human Homo sapiens Human MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ sptc1_human Serine palmitoyltransferase 1 Serine-palmitoyl-CoA transferase 1 Long chain base biosynthesis protein 1 SPTLC1 LCB1 protein protein human Homo sapiens Human MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL sptc3_human Serine palmitoyltransferase 3 SPTLC3 C20orf38 SPTLC2L Long chain base biosynthesis protein 2b Long chain base biosynthesis protein 3 Serine-palmitoyl-CoA transferase 3 protein protein human Homo sapiens Human MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWKKILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPHEVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMGLDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLEKKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSRHKKSARPELYDETSFELED sptsb_human Serine palmitoyltransferase small subunit B SPTSSB ADMP C3orf57 SSSPTB Protein ADMP Small subunit of serine palmitoyltransferase B protein protein human Homo sapiens Human MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN sptc2_human Serine palmitoyltransferase 2 Serine-palmitoyl-CoA transferase 2 Long chain base biosynthesis protein 2 SPTLC2 KIAA0526 LCB2 Long chain base biosynthesis protein 2a protein protein human Homo sapiens Human MRPEPGGCCCRRTVRANGCVANGEVRNGYVRSSAAAAAAAAAGQIHHVTQNGGLYKRPFNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVEYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETED sptlc3-sptlc1-1 3190146 N/A 3190156 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190158 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sptlc1-sptlc3-1 3190147 N/A 3190158 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc3-sptssb-1 3190148 N/A 3190159 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190158 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc3-sptlc1-2 3190149 N/A 3190159 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190158 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sptlc2-sptssb-1 3190150 N/A 3190159 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190160 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc3-sptssa-1 3190151 N/A 3190156 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190158 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc1-sptssa-1 3190152 N/A 3190156 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc1-sptlc2-1 3190153 N/A 3190160 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc2-sptssa-1 3190154 N/A 3190156 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190160 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sptlc1-sptssb-1 3190155 N/A 3190159 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190157 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false