DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ inagawa-2009-1 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134184X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions imex curation inagawa-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134182X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions imex curation inagawa-2009-3 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134183X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions imex curation pcna_schpo Proliferating cell nuclear antigen pcn1 pcn SPBC16D10.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSMLIKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNLVFESEKNDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLTLSDSVTINASKEGVRFSCKGDIGNGSTTLKQHTDLSDQDQSIEISLTQAVTLTFSLKYLAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPKIGEEDEE 1EE5B2A27A899C4E rtf2_schpo Replication termination factor 2 rtf2 SPAC1D4.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITDEPLYPPIVSCGLGKLYNKASILQMLLDRSSVPKSPSHIKSLKDVVQLQVELDDSGKVLWLCPITRHVMSDTYQFAYIVPCGHVFEYSALKQFGEKMCFQCNQVYEEKDVIPINPNAEQLKTLSKRLLDLALSEKTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRMLDGENVKSETSVTDMERVKRVKI 6C05265CE64DD889 pcn1-rtf2-1 3190113 N/A 3190116 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3190117 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false rtf2-pcn1-1 3190114 N/A 3190116 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3190117 unspecified role unspecified role bait bait Q10154:p.Cys141Gly C141G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pcn1-rtf2-2 3190115 N/A 3190116 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3190117 unspecified role unspecified role prey prey Q10154:p.Cys141Gly C141G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false