DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yu-2009-4 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Yu JW., Jeffrey PD., Shi Y. DIP original experiment: DIP-260265X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Mechanism of procaspase-8 activation by c-FLIPL. Yu JW., Jeffrey PD., Shi Y. Only protein-protein interactions imex curation yu-2009-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yu JW., Jeffrey PD., Shi Y. DIP original experiment: DIP-260263X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Mechanism of procaspase-8 activation by c-FLIPL. Yu JW., Jeffrey PD., Shi Y. Only protein-protein interactions imex curation yu-2009-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yu JW., Jeffrey PD., Shi Y. DIP original experiment: DIP-260264X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Mechanism of procaspase-8 activation by c-FLIPL. Yu JW., Jeffrey PD., Shi Y. Only protein-protein interactions imex curation o15519-1 CASP8 and FADD-like apoptosis regulator FLIP-L CLARP1 MRIT alpha-1 CASH alpha I-FLICE 1 FLAME-1 gamma Usurpin alpha CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT q14790-2 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Alpha-2 MCH5-beta protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD casp8-cflar-2 3190092 N/A 3190095 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 209-480 Region 209-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O15519-1:p.Gln468Asp Q468D mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3190096 enzyme enzyme unspecified role unspecified role Region 202-464 Region 202-464 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli protein cleavage protein cleavage false false false casp8-cflar-3 3190093 N/A 3190095 unspecified role unspecified role unspecified role unspecified role Region 209-480 Region 209-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3190096 unspecified role unspecified role unspecified role unspecified role Region 202-464 Region 202-464 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false casp8-cflar-4 3190094 N/A 3190095 unspecified role unspecified role unspecified role unspecified role Region 209-480 Region 209-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3190096 unspecified role unspecified role unspecified role unspecified role Region 202-464 Region 202-464 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false