DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cheung-2009-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung TC., Steinberg MW., Oborne LM., Macauley MG., Fukuyama S., Sanjo H., D'Souza C., Norris PS., Pfeffer K., Murphy KM., Kronenberg M., Spear PG., Ware CF. DIP original experiment: DIP-134076X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Unconventional ligand activation of herpesvirus entry mediator signals cell survival. Cheung TC., Steinberg MW., Oborne LM., Macauley MG., Fukuyama S., Sanjo H., D'Souza C., Norris PS., Pfeffer K., Murphy KM., Kronenberg M., Spear PG., Ware CF. Only protein-protein interactions imex curation cheung-2009-3 human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Cheung TC., Steinberg MW., Oborne LM., Macauley MG., Fukuyama S., Sanjo H., D'Souza C., Norris PS., Pfeffer K., Murphy KM., Kronenberg M., Spear PG., Ware CF. DIP original experiment: DIP-134077X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Unconventional ligand activation of herpesvirus entry mediator signals cell survival. Cheung TC., Steinberg MW., Oborne LM., Macauley MG., Fukuyama S., Sanjo H., D'Souza C., Norris PS., Pfeffer K., Murphy KM., Kronenberg M., Spear PG., Ware CF. Only protein-protein interactions imex curation traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL tnr14_human Tumor necrosis factor receptor superfamily member 14 TNFRSF14 HVEA HVEM UNQ329/PRO509 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 protein protein human Homo sapiens Human MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH btla_human B- and T-lymphocyte attenuator BTLA B- and T-lymphocyte-associated protein protein protein human Homo sapiens Human MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS tnfrsf14-traf2-1 3186401 N/A 3186403 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3186404 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false btla-1 3186402 N/A 3186405 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept DsRed-tag DsRed-tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3186405 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false