DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mathas-2009-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. DIP original experiment: DIP-134043X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma. Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. Only protein-protein interactions imex curation mathas-2009-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. DIP original experiment: DIP-134046X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma. Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. Only protein-protein interactions imex curation mathas-2009-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. DIP original experiment: DIP-134044X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma. Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. Only protein-protein interactions imex curation mathas-2009-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. DIP original experiment: DIP-134047X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma. Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. Only protein-protein interactions imex curation mathas-2009-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. DIP original experiment: DIP-134045X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma. Mathas S., Kreher S., Meaburn KJ., Jöhrens K., Lamprecht B., Assaf C., Sterry W., Kadin ME., Daibata M., Joos S., Hummel M., Stein H., Janz M., Anagnostopoulos I., Schrock E., Misteli T., Dörken B. Only protein-protein interactions imex curation junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL id2_mouse DNA-binding protein inhibitor ID-2 Id2 Id-2 Idb2 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 protein protein mouse Mus musculus Mouse MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG tfe2_mouse Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM id2_human DNA-binding protein inhibitor ID-2 Inhibitor of DNA binding 2 ID2 BHLHB26 Class B basic helix-loop-helix protein 26 Inhibitor of differentiation 2 protein protein human Homo sapiens Human MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG htf4_mouse Transcription factor 12 Tcf12 Alf1 Meb Transcription factor HTF-4 E-box-binding protein DNA-binding protein HTF4 Class A helix-loop-helix transcription factor ME1 protein protein mouse Mus musculus Mouse MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGMDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGTHEGLSPTPFMNSNLIGKTSERGSFSLYSRDSGLSGCQSSLLRQDLGLGSPAQLSSSGKPGTPYYSFSATSSRRRPLHDSVALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHSSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTPVGSPSPLTGTSQWPRAGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPTSHSDIHSLLGPSHNASIGNLNSNYGGSSLVTNSRSASMVGTHREDSVSLNGNHSVLSSTVAASNTELNHKTPENFRGGVQNQSGSVVPTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAASAEPPNTLPGAHPGLSESTNPMGHL mint Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems htf4_human Transcription factor 12 Transcription factor HTF-4 E-box-binding protein DNA-binding protein HTF4 TCF12 HEB HTF4 BHLHB20 Class B basic helix-loop-helix protein 20 protein protein human Homo sapiens Human MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM fosl2-junb-2 3186168 N/A 3186173 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3186174 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false id2-tcf3-2 3186169 N/A 3186175 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3186176 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false id2-tcf3-3 3186170 N/A 3186177 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3186178 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false id2-tcf12-2 3186171 N/A 3186179 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3186175 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false id2-tcf12-3 3186172 N/A 3186180 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3186178 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false