DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ okuda-2009-1 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216532X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation okuda-2009-2 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216535X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation okuda-2009-3 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216534X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation okuda-2009-4 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216536X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation okuda-2009-5 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216533X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation okuda-2009-6 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216537X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Okuda S., Tokuda H. Only protein-protein interactions imex curation lolb_ecoli Outer-membrane lipoprotein LolB ychC lolB hemM b1209 JW1200 protein protein ecoli Escherichia coli (strain K12) MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK lola_ecoli Outer-membrane lipoprotein carrier protein yzzV P20 lolA lplA b0891 JW0874 protein protein ecoli Escherichia coli (strain K12) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK lolc_ecoli Lipoprotein-releasing system transmembrane protein LolC lolC ycfU b1116 JW5161 protein protein ecoli Escherichia coli (strain K12) MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE pal_ecoli Peptidoglycan-associated lipoprotein pal excC b0741 JW0731 Tol-Pal system lipoprotein Pal protein protein ecoli Escherichia coli (strain K12) MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY lola-lolb-1 3186087 N/A 3186093 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3186094 unspecified role unspecified role unspecified role unspecified role V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false K155pBPA K155pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q173pBPA Q173pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lola-lolc-1 3186088 N/A 3186095 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3186094 unspecified role unspecified role unspecified role unspecified role V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false D55pBPA D55pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false T176pBPA T176pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lolb-pal-1 3186089 N/A 3186096 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3186093 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false V46pBPA V46pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false W52pBPA W52pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Y39pBPA Y39pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false D86pBPA D86pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false R91pBPA R91pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false R115pBPA R115pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false N144pBPA N144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Y152pBPA Y152pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q174pBPA Q174pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lola-lolb-2 3186090 N/A 3186093 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false I40pBPA I40pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false K45pBPA K45pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false R49pBPA R49pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false T65pBPA T65pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3186094 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false lola-pal-1 3186091 N/A 3186096 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3186094 unspecified role unspecified role unspecified role unspecified role V20pBPA V20pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false R43pBPA R43pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false F90pBPA F90pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false I93pBPA I93pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false S99pBPA S99pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false F127pBPA F127pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false T176pBPA T176pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lola-lolc-2 3186092 N/A 3186095 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3186094 unspecified role unspecified role unspecified role unspecified role Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false