DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sakamoto-2009-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Sakamoto K., Murayama K., Oki K., Iraha F., Kato-Murayama M., Takahashi M., Ohtake K., Kobayashi T., Kuramitsu S., Shirouzu M., Yokoyama S. DIP original experiment: DIP-132109X Structure (London, England : 1993) 2009 IMEx Genetic encoding of 3-iodo-L-tyrosine in Escherichia coli for single-wavelength anomalous dispersion phasing in protein crystallography. Sakamoto K., Murayama K., Oki K., Iraha F., Kato-Murayama M., Takahashi M., Ohtake K., Kobayashi T., Kuramitsu S., Shirouzu M., Yokoyama S. Only protein-protein interactions imex curation sakamoto-2009-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sakamoto K., Murayama K., Oki K., Iraha F., Kato-Murayama M., Takahashi M., Ohtake K., Kobayashi T., Kuramitsu S., Shirouzu M., Yokoyama S. DIP original experiment: DIP-132110X Structure (London, England : 1993) 2009 IMEx Genetic encoding of 3-iodo-L-tyrosine in Escherichia coli for single-wavelength anomalous dispersion phasing in protein crystallography. Sakamoto K., Murayama K., Oki K., Iraha F., Kato-Murayama M., Takahashi M., Ohtake K., Kobayashi T., Kuramitsu S., Shirouzu M., Yokoyama S. Only protein-protein interactions imex curation q5shd1_thet8 N-acetyltransferase domain-containing protein TTHA1799 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLYGASGNP q5shd1_thet8-1 3185636 N/A 3185638 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5shd1_thet8-2 3185637 N/A 3185638 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false