DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ miura-2009-1 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Miura K., Lee J., Jin JB., Yoo CY., Miura T., Hasegawa PM. DIP original experiment: DIP-134014X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sumoylation of ABI5 by the Arabidopsis SUMO E3 ligase SIZ1 negatively regulates abscisic acid signaling. Miura K., Lee J., Jin JB., Yoo CY., Miura T., Hasegawa PM. Only protein-protein interactions imex curation miura-2009-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Miura K., Lee J., Jin JB., Yoo CY., Miura T., Hasegawa PM. DIP original experiment: DIP-134015X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sumoylation of ABI5 by the Arabidopsis SUMO E3 ligase SIZ1 negatively regulates abscisic acid signaling. Miura K., Lee J., Jin JB., Yoo CY., Miura T., Hasegawa PM. Only protein-protein interactions imex curation abi5_arath Protein ABSCISIC ACID-INSENSITIVE 5 At2g36270 ABI5 BZIP39 DPBF1 GIA1 NEM1 Dc3 promoter-binding factor 1 Protein GROWTH-INSENSITIVITY TO ABA 1 bZIP transcription factor 39 F2H17.12 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVTRETKLTSEREVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGKNFGSMNMDEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSGGSRGNEDANNKRGIANESSLPRQGSLTLPAPLCRKTVDEVWSEIHRGGGSGNGGDSNGRSSSSNGQNNAQNGGETAARQPTFGEMTLEDFLVKAGVVREHPTNPKPNPNPNQNQNPSSVIPAAAQQQLYGVFQGTGDPSFPGQAMGVGDPSGYAKRTGGGGYQQAPPVQAGVCYGGGVGFGAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQYGVDMGGLRGRKRVVDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLKSRAQPKLPKSNGRLRTLMRNPSCPL sumo1_arath Small ubiquitin-related modifier 1 SUMO1 SMT3 SUM1 Ubiquitin-like protein SMT3 F10M23.180 At4g26840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA This sequence has been withdrawn from Uniprot. 6F1E8721E7734A4A abi5-sumo-1 3185603 N/A 3185605 unspecified role unspecified role bait bait Q9SJN0:p.Lys391Arg K391R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3185606 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false abi5-sumo-2 3185604 N/A 3185605 unspecified role unspecified role unspecified role unspecified role Q9SJN0:p.Lys391Arg K391R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3185606 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false