DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lemeille-2009-1 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132590X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-2 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132592X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-3 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132591X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-4 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132596X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132595X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-6 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132593X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation lemeille-2009-7 chlre Chlamydomonas reinhardtii Chlamydomonas smithii pull down pull down western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132594X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions imex curation a8j9y1_chlre PETC CHLREDRAFT_193296 CHLRE_11g467689v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTLALGYGAFFVPPSSGGGGGGQAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAESGLVTFSTWTETDFRTGLEPWWA q9zsj4_chlre Chlorophyll a-b binding protein, chloroplastic Lhcb3 LHCBM5 CHLREDRAFT_184775 CHLRE_03g156900v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MMLSRTVVNVQAKLTKKGGAPKKAAPASAQKKTIREKAGWWSNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGTPIVEPVWFKAGAQIFAEGGLDYLGNPGLVHAQSILATLAVQVILMGAIEGYRVNGGPAGEGLDKLHPGGQFFDPLGLAEDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLANLDEHLASPFTSNAFTYAQKFTPQ q9fek6_chlre Chlorophyll a-b binding protein, chloroplastic lhcb5 LHCB5 CHLREDRAFT_184397 CHLRE_16g673650v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQIQALFKKTGASAPAKKGTASTKVVKPSKAGGKATRGWLGGQGGAADLDKWYGPDRKLFLPSGLYDRSEIPEYLNGELAGDYGYDPLGLGKDPETVAKYRENELLHARWAMLAAAGILIPEGLQANGANIKGGTWFETGAEMLNGGTLNYFAVPWGIVSNPLPLFAVIAVEVGLMGAVEFYRRNGTGPAGYSPGIGKFDSSVFDGLDPLYPGGPFDPLGLADDPEVLQELKVKEIKNGRLAMVSVLGFAVQSYVTGEGPYANWTKHVADPFGYNLLTVLGAEERTPTL cb29_chlre Chlorophyll a-b binding protein CP29 Lhcb4 Lhcbm4 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MVFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL psaa_chlre Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG stt7_chlre Serine/threonine-protein kinase stt7, chloroplastic STT7 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MALAQRQVSCRIERSTGASTSQPVGSCLLVQRRPGQRRGVPARATPEFIDALSALVPNLPLEQIAAPCQVMKCGDIVYRSTLDPSLYNEAGFDEKTVALLAPVLAYLFLPPGVLPGAIDYYIRAPLKRKQTKAIDKNDIVLGKRLGTGGFGTVFKGELKEEGGVKTSIIIKKAKEFGEAEVWMNERMSRVAGHHVAEFVTAFDESLNVPLPAAAGKRAAPVQPTSPLDANSIWLVWVYEGDNTLSSLMERREWPYNLEPLLFGRELRAPRGPVRELVTIKEAFRQLVQAVAACHSVGIVHRDIKPANCIVSERDKKIKLIDLGAAADLRIGINYVPNEYLLDPRYAPPQQYIMSTQTPKPPPKPVAAFLSPILWTMEKPDRFDMYSCGITLLQMVFGHLRNDNALIAFNKRLQELKWDLPAWRREEEAKLPSAKGALAESLEAGFEALDADGGAGWDLLMRLLAYKPTDRPSAAAVLAHPWLTSAPGRTASLQHSLSGSFEATVSTAAAATSTALTAAGKSLGQAAKDAGLASMEEAILKVNQGALTEAQLMEELGLQEPAPVAPREGSQTIAWWQERQNELKARLVERREAMSESDPYGAAPSAMQVGSAINNARGGKGAKPTTPVKPTGPMAAAGAAAAAAAAAARVEAKVKVPNILGVKKPASGGGSNGRANGNGNGKAAPAKAANGNGSGNGNTNGNGNGAKQQLFGGLLGRKQQPVEEVQEEPEEEVEPEQETASKKERAFNLLGVFRR cyf_chlre Cytochrome f petA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MSNQVFTTLRAATLAVILGMAGGLAVSPAQAYPVFAQQNYANPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVKQVLANGKKGDLNVGMVLILPEGFELAPPDRVPAEIKEKVGNLYYQPYSPEQKNILVVGPVPGKKYSEMVVPILSPDPAKNKNVSYLKYPIYFGGNRGRGQVYPDGKKSNNTIYNASAAGKIVAITALSEKKGGFEVSIEKANGEVVVDKIPAGPDLIVKEGQTVQADQPLTNNPNVGGFGQAETEIVLQNPARIQGLLVFFSFVLLTQVLLVLKKKQFEKVQLAEMNF stt7-lhcb3-1 3185420 N/A 3185427 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185428 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185429 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185430 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185431 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185433 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association false false false psaa-stt7-1 3185421 N/A 3185431 unspecified role unspecified role bait bait chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii physical association physical association false false false stt7-lhcb3-2 3185422 N/A 3185427 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185428 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185429 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185431 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185433 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association false false false stt7-peta-1 3185423 N/A 3185431 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185427 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185433 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association false false false stt7-petc-1 3185424 N/A 3185427 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false peta-stt7-1 3185425 N/A 3185432 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185433 unspecified role unspecified role bait bait chlre Chlamydomonas reinhardtii Chlamydomonas smithii physical association physical association false false false peta-petc-1 3185426 N/A 3185427 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185432 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii N/A 3185433 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association false false false