DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ inui-2009-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-133996X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-133999X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-134001X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-134002X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-133997X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-6 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-134000X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation inui-2009-7 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. DIP original experiment: DIP-133998X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12. Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Only protein-protein interactions imex curation tyobp_mouse TYRO protein tyrosine kinase-binding protein Tyrobp Dap12 Karap DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein mouse Mus musculus Mouse MGALEPSWCLLFLPVLLTVGGLSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR hcst_mouse Hematopoietic cell signal transducer Hcst Dap10 Kap10 DNAX-activation protein 10 Membrane protein DAP10 Transmembrane adapter protein KAP10 protein protein mouse Mus musculus Mouse MDPPGYLLFLLLLPVAASQTSAGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGRVYINMPGRG clc5a_mouse C-type lectin domain family 5 member A Clec5a Clecsf5 Mdl1 C-type lectin superfamily member 5 Myeloid DAP12-associating lectin 1 protein protein mouse Mus musculus Mouse MNWHMIISGLIVVVIKVVGMTFFLLYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK clec5a-hcst-1 3185148 N/A 3185155 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185156 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185157 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false tyrobp-clec5a-1 3185149 N/A 3185155 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3185156 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185157 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false clec5a-hcst-2 3185150 N/A 3185156 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185157 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false tyrobp-hcst-1 3185151 N/A 3185155 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3185156 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false hcst-tyrobp-1 3185152 N/A 3185155 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185156 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false clec5a-tyrobp-1 3185153 N/A 3185155 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185157 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false hcst-clec5a-1 3185154 N/A 3185155 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185156 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3185157 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false