DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2009-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132971X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132977X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132974X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-11 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132979X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-12 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132972X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-13 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132978X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-14 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132976X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132973X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-16 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132975X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation zhao-2009-17 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. DIP original experiment: DIP-132980X Nature structural & molecular biology 2009 IMEx PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing. Zhao Q., Rank G., Tan YT., Li H., Moritz RL., Simpson RJ., Cerruti L., Curtis DJ., Patel DJ., Allis CD., Cunningham JM., Jane SM. Only protein-protein interactions imex curation nfe4_human Transcription factor NF-E4 NFE4 protein protein human Homo sapiens Human MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL h4r3 H4R3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SGRGKGGKGLGKGGAKRHRK dnm3a_human DNA (cytosine-5)-methyltransferase 3A DNMT3A DNA methyltransferase HsaIIIA Cysteine methyltransferase DNMT3A protein protein human Homo sapiens Human MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV nucl_human Nucleolin NCL Protein C23 protein protein human Homo sapiens Human MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE icln_human Methylosome subunit pICln Chloride conductance regulatory protein ICln Chloride channel, nucleotide sensitive 1A Chloride ion current inducer protein Reticulocyte pICln CLNS1A ICLN CLCI protein protein human Homo sapiens Human MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH q86uq8-1 Transcription factor NF-E4 NFE4 p22 NF-E4 protein protein human Homo sapiens Human MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG prmt5-nfe4-1 3184773 N/A 3184783 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3184784 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false h4r3-dnmt3a-1 3184774 N/A 3184785 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false R3-me2 R3-me2 nonome2arg asymmetric dimethyl-L-arginine (2S)-2-amino-5-([(dimethylamino)(imino)methyl]amino)pentanoic acid MOD_RES Asymmetric dimethylarginine MOD_RES Omega-N-methylated arginine N5-[(dimethylamino)(imino)methyl]ornithine NG,NG-dimethylarginine asymmetric dimethylarginine omega-N,omega-N-dimethlyated L-arginine omega-N,omega-N-dimethyl-L-arginine Dimethyl NoNoMe2Arg di-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3184786 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false nfe4-clns1a-1 3184775 N/A 3184787 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3184788 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3184789 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3184784 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dnmt3a-prmt5-1 3184776 N/A 3184784 unspecified role unspecified role prey prey in vitro In vitro N/A 3184786 unspecified role unspecified role bait bait Region 281-424 Region 281-424 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false dnmt3a-prmt5-2 3184777 N/A 3184786 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3184784 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false prmt5-dnmt3a-1 3184778 N/A 3184784 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3184786 unspecified role unspecified role prey prey Region 1-354 Region 1-354 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false h4r3-dnmt3a-2 3184779 N/A 3184785 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false R3-me2 R3-me2 nonome2arg asymmetric dimethyl-L-arginine (2S)-2-amino-5-([(dimethylamino)(imino)methyl]amino)pentanoic acid MOD_RES Asymmetric dimethylarginine MOD_RES Omega-N-methylated arginine N5-[(dimethylamino)(imino)methyl]ornithine NG,NG-dimethylarginine asymmetric dimethylarginine omega-N,omega-N-dimethlyated L-arginine omega-N,omega-N-dimethyl-L-arginine Dimethyl NoNoMe2Arg di-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3184786 unspecified role unspecified role prey prey Region 479-610 Region 479-610 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false prmt5-dnmt3a-2 3184780 N/A 3184786 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3184784 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false h4r3-dnmt3a-3 3184781 N/A 3184785 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false R3-me2 R3-me2 nonome2arg asymmetric dimethyl-L-arginine (2S)-2-amino-5-([(dimethylamino)(imino)methyl]amino)pentanoic acid MOD_RES Asymmetric dimethylarginine MOD_RES Omega-N-methylated arginine N5-[(dimethylamino)(imino)methyl]ornithine NG,NG-dimethylarginine asymmetric dimethylarginine omega-N,omega-N-dimethlyated L-arginine omega-N,omega-N-dimethyl-L-arginine Dimethyl NoNoMe2Arg di-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3184786 unspecified role unspecified role prey prey Region 1-587 Region 1-587 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false nfe4-prmt5-1 3184782 N/A 3184789 unspecified role unspecified role bait bait Region 49-100 Region 49-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3184784 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false