DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ feldman-2009-1 mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Feldman ME., Apsel B., Uotila A., Loewith R., Knight ZA., Ruggero D., Shokat KM. DIP original experiment: DIP-132560X PLoS biology 2009 IMEx Active-site inhibitors of mTOR target rapamycin-resistant outputs of mTORC1 and mTORC2. Feldman ME., Apsel B., Uotila A., Loewith R., Knight ZA., Ruggero D., Shokat KM. Only protein-protein interactions imex curation 4ebp1_mouse Eukaryotic translation initiation factor 4E-binding protein 1 Eif4ebp1 Phosphorylated heat- and acid-stable protein regulated by insulin 1 protein protein mouse Mus musculus Mouse MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI if4e_mouse Eukaryotic translation initiation factor 4E Eif4e eIF-4F 25 kDa subunit protein protein mouse Mus musculus Mouse MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV eif4e-eif4ebp1-14 3184122 N/A 3184123 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3184124 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false