DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rosan-2009-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133762X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133767X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133765X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133770X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133763X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133768X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133766X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133764X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133769X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation rosan-2009-10 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. DIP original experiment: DIP-133771X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Beta-arrestin links endothelin A receptor to beta-catenin signaling to induce ovarian cancer cell invasion and metastasis. Rosanò L., Cianfrocca R., Masi S., Spinella F., Di Castro V., Biroccio A., Salvati E., Nicotra MR., Natali PG., Bagnato A. Only protein-protein interactions imex curation ednra_human Endothelin-1 receptor Endothelin receptor type A EDNRA ETA ETRA protein protein human Homo sapiens Human METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD arrb1_rat Beta-arrestin-1 Arrb1 Arrestin beta-1 protein protein rat Rattus norvegicus (Rat) Rat MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR arrb1-ednra-1 3183939 N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183950 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ctnnb1-tcf7l2-1 3183940 N/A 3183951 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183952 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arrb2-ednra-1 3183941 N/A 3183953 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183954 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false axin1-gsk3b-12 3183942 N/A 3183955 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183956 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arrb2-ednra-2 3183943 N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183954 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false axin1-arrb1-1 3183944 N/A 3183950 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183956 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false src-ednra-1 3183945 N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183953 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arrb1-ednra-2 3183946 N/A 3183953 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183950 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false arrb1-axin1-1 3183947 N/A 3183949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183956 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3183950 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false src-arrb1-2 3183948 N/A 3183957 unspecified role unspecified role prey prey P29066:p.Ser412Asp S412D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3183953 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false