DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ song-2009-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133704X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation song-2009-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133702X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation song-2009-4 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133703X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation epic1_phyin Cystatin-like cysteine protease inhibitor EPIC1 EPIC1 Extracellular protease inhibitor with cystatin-like domain protein 1 Secreted effector EPIC1 protein protein phyin Phytophthora infestans Potato late blight fungus Botrytis infestans MTFLRPILALLAATALVTTSAQVDGGYSKKEVTPEDMELLQKAQSNVSAYNSDVTSRICYLKVDSLETQVVSGENYKFHVSGCSVNSDNELGGCANQNCESSKYDIVIYSQSWTNTLEVTSITPVK q8s335_solpi Rcr3 protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MAMKVDLMNILITLFFVISMFNTQTRGRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMNEFADITSQEFLAKFTGLNIPNSYLSPSPMSSTEFKINDLSDDYMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEGAYKIATGNLMEFSEQELLDCTTNNYGCNGGLMTNAFDFIIENGGISRESDYEYLGEQYTCRSREKTAAVQISSYKVVPEGETSLLQAVTKQPVSIGIAASQDLQFYAGGTYDGNCADQINHAVTAIGYGTDEEGQKYWLLKNSWGTSWGENGFMKIIRDSGDPSGLCDIAKMSSYPNIA q8nid8_pasfu avr2 protein protein pasfu Passalora fulva Tomato leaf mold Cladosporium fulvum MKLFILTFIWLLTASEVIAAAKKLPGCDKDPCKVKEKSGKYKLKIGAKCSATCDGKLTRGGTCENVQGNHLCCFGLCG epi2b_phyin Cystatin-like cysteine protease inhibitor EPIC2B EPIC2B Extracellular protease inhibitor with cystatin-like domain protein 2B Secreted effector EPIC2B protein protein phyin Phytophthora infestans Potato late blight fungus Botrytis infestans MSFLRPTLALLAVTALVTTSGQLNGYSKKEVTPEDTELLQKAQSNVSAYNSDVTSRICYLKVDSLETQVVSGENYKFHVSGCSVNSDKELGGCANQNCESSKYDIVIYSQSWTNTLKVTSITPAN a1l015_phyin-rcr3-1 3183332 N/A 3183335 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false avr2-rcr3-1 3183333 N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3183337 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false a1l017_phyin-rcr3-1 3183334 N/A 3183338 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false